Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Intelectin-1 (ITLN1)

Product Specifications

Product Name Alternative

(ITLN-1) (Endothelial lectin HL-1) (Galactofuranose-binding lectin) (Intestinal lactoferrin receptor) (Omentin)

Abbreviation

Recombinant Human ITLN1 protein

Gene Name

ITLN1

UniProt

Q8WWA0

Expression Region

19-298aa

Organism

Homo sapiens (Human)

Target Sequence

TDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLRTENGVIYQTFCDMTSGGGGWTLVASVHENDMRGKCTVGDRWSSQQGSKAVYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNSSLLRYRTDTGFLQTLGHNLFGIYQKYPVKYGEGKCWTDNGPVIPVVYDFGDAQKTASYYSPYGQREFTAGFVQFRVFNNERAANALCAGMRVTGCNTEHHCIGGGGYFPEASPQQCGDFSGFDWSGYGTHVGYS

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Lectin that specifically recognizes microbial carbohydrate chains in a calcium-dependent manner. Binds to microbial glycans that contain a terminal acyclic 1,2-diol moiety, including beta-linked D-galactofuranose (beta-Galf), D-phosphoglycerol-modified glycans, D-glycero-D-talo-oct-2-ulosonic acid (KO) and 3-deoxy-D-manno-oct-2-ulosonic acid (KDO) . Binds to glycans from Gram-positive and Gram-negative bacteria, including K.pneumoniae, S.pneumoniae, Y.pestis, P.mirabilis and P.vulgaris. Does not bind human glycans. Probably plays a role in the defense system against microorganisms (Probable) . May function as adipokine that has no effect on basal glucose uptake but enhances insulin-stimulated glucose uptake in adipocytes. Increases AKT phosphorylation in the absence and presence of insulin. May interact with lactoferrin/LTF and increase its uptake, and may thereby play a role in iron absorption.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

38.6 kDa

References & Citations

"Molecular cloning and functional expression of a human intestinal lactoferrin receptor." Suzuki Y.A., Shin K., Loennerdal B. Biochemistry 40:15771-15779 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Phospholipase A2 (PLA2G4A) ELISA KIT (1 x 96 wells)
EA102742 96 Well

Human Phospholipase A2 (PLA2G4A) ELISA KIT (1 x 96 wells)

Sign In for Pricing
View Details
Docosanoic-7,7,8,8-d4 Acid
TMID-0264-01 1 mg

Docosanoic-7,7,8,8-d4 Acid

Sign In for Pricing
View Details
Docosanoic-7,7,8,8-d4 Acid
TMID-0264-02 5 mg

Docosanoic-7,7,8,8-d4 Acid

Sign In for Pricing
View Details
Secisbp2l sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3467206 1.0 µg DNA

Secisbp2l sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
KCTD1 (NM_001136205) Human Tagged ORF Clone
RG226740 10 µg

KCTD1 (NM_001136205) Human Tagged ORF Clone

Sign In for Pricing
View Details
Human TSTD3 activation kit by CRISPRa
GA119131 1 Kit

Human TSTD3 activation kit by CRISPRa

Sign In for Pricing
View Details