Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD44, Mouse (HEK293, His)

The CD44 protein binds to hyaluronic acid and TGF-β receptors and contributes to cytokine function. CD44 is involved in T cell activation, protein phosphorylation, and Wnt signaling and is strategically located in the plasma membrane and microvilli. CD44 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD44 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD44 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd44-protein-mouse-hek293-his.html

Purity

95.00

Smiles

QIDLNVTCRYAGVFHVEKNGRYSISRTEAADLCQAFNSTLPTMDQMKLALSKGFETCRYGFIEGNVVIPRIHPNAICAANHTGVYILVTSNTSHYDTYCFNASAPPEEDCTSVTDLPNSFDGPVTITIVNRDGTRYSKKGEYRTHQEDIDASNIIDDDVSSGSTIEKSTPESYILHTYLPTEQPTGDQDDSFFIRSTLAT

Molecular Formula

12505 (Gene_ID) NP_001034240.1 (Q25-T224) (Accession)

Molecular Weight

Approximately 37 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (N/A), CF405S conjugate, 0.1mg/mL
BNC041826-500 1x 500 µL

Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (N/A), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Milataxel
TRC-M344250-75MG 75 mg

Milataxel

Sign In for Pricing
View Details
CRSP8 (MED27) (NM_004269) Human Over-expression Lysate
LC418056 20 µg

CRSP8 (MED27) (NM_004269) Human Over-expression Lysate

Sign In for Pricing
View Details
trans-3-Hydroxystilbene
TRC-H953993-500MG 500 mg

trans-3-Hydroxystilbene

Sign In for Pricing
View Details
CPS1 (NM_001875) Human Over-expression Lysate
LY419674 100 µg

CPS1 (NM_001875) Human Over-expression Lysate

Sign In for Pricing
View Details
Galectin 1 Recombinant Rabbit monoclonal Antibody [JM13-37]
ET1705-83-50UL 50 µL

Galectin 1 Recombinant Rabbit monoclonal Antibody [JM13-37]

Sign In for Pricing
View Details