Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD44, Mouse (HEK293, His)

The CD44 protein binds to hyaluronic acid and TGF-β receptors and contributes to cytokine function. CD44 is involved in T cell activation, protein phosphorylation, and Wnt signaling and is strategically located in the plasma membrane and microvilli. CD44 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD44 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD44 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd44-protein-mouse-hek293-his.html

Purity

95.00

Smiles

QIDLNVTCRYAGVFHVEKNGRYSISRTEAADLCQAFNSTLPTMDQMKLALSKGFETCRYGFIEGNVVIPRIHPNAICAANHTGVYILVTSNTSHYDTYCFNASAPPEEDCTSVTDLPNSFDGPVTITIVNRDGTRYSKKGEYRTHQEDIDASNIIDDDVSSGSTIEKSTPESYILHTYLPTEQPTGDQDDSFFIRSTLAT

Molecular Formula

12505 (Gene_ID) NP_001034240.1 (Q25-T224) (Accession)

Molecular Weight

Approximately 37 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8A CytoSection
TS427316P5 25 Slides

CD8A CytoSection

Sign In for Pricing
View Details
Zfyve26 Mouse Gene Knockout Kit (CRISPR)
KN520072 1 Kit

Zfyve26 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ferritin, Light Chain (Node-Negative Breast Tumor Prognostic Marker) (rFTL/1388), CF405S conjugate, 0.1mg/mL
BNC043771-100 1x 100 µL

Ferritin, Light Chain (Node-Negative Breast Tumor Prognostic Marker) (rFTL/1388), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MDM4 (Ab-367) Antibody
8B8369-AAT 50 µg

MDM4 (Ab-367) Antibody

Sign In for Pricing
View Details
CCL21 Antibody
KC-7319-01 50 μL

CCL21 Antibody

Sign In for Pricing
View Details
CCL21 Antibody
KC-7319-02 100 µL

CCL21 Antibody

Sign In for Pricing
View Details