Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD44, Mouse (HEK293, His)

The CD44 protein binds to hyaluronic acid and TGF-β receptors and contributes to cytokine function. CD44 is involved in T cell activation, protein phosphorylation, and Wnt signaling and is strategically located in the plasma membrane and microvilli. CD44 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD44 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD44 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd44-protein-mouse-hek293-his.html

Purity

95.00

Smiles

QIDLNVTCRYAGVFHVEKNGRYSISRTEAADLCQAFNSTLPTMDQMKLALSKGFETCRYGFIEGNVVIPRIHPNAICAANHTGVYILVTSNTSHYDTYCFNASAPPEEDCTSVTDLPNSFDGPVTITIVNRDGTRYSKKGEYRTHQEDIDASNIIDDDVSSGSTIEKSTPESYILHTYLPTEQPTGDQDDSFFIRSTLAT

Molecular Formula

12505 (Gene_ID) NP_001034240.1 (Q25-T224) (Accession)

Molecular Weight

Approximately 37 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C9orf86 (RABL6) (NM_001173989) Human Over-expression Lysate
LY432869 100 µg

C9orf86 (RABL6) (NM_001173989) Human Over-expression Lysate

Sign In for Pricing
View Details
NF-kB p65 (RELA) Mouse Monoclonal Antibody [Clone ID: 3D2-4E9-7A8]
TA385155 100 µL

NF-kB p65 (RELA) Mouse Monoclonal Antibody [Clone ID: 3D2-4E9-7A8]

Sign In for Pricing
View Details
(+/-)-1-(1,3-Benzodioxol-5-yl)-2-bromo-1-pentanone
TRC-B203490-25MG 25 mg

(+/-)-1-(1,3-Benzodioxol-5-yl)-2-bromo-1-pentanone

Sign In for Pricing
View Details
Plastin L Antibody
OC-374-01 50 μL

Plastin L Antibody

Sign In for Pricing
View Details
Plastin L Antibody
OC-374-02 100 µL

Plastin L Antibody

Sign In for Pricing
View Details
Plastin L Antibody
OC-374-03 1 mL

Plastin L Antibody

Sign In for Pricing
View Details