Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Bone marrow proteoglycan (PRG2), partial

Product Specifications

Product Name Alternative

Proteoglycan 2 Cleaved into the following chain: Eosinophil granule major basic protein Short name: EMBP Short name: MBP Alternative name (s) : Pregnancy-associated major basic protein

Abbreviation

Recombinant Human PRG2 protein, partial

Gene Name

PRG2

UniProt

P13727

Expression Region

17-104aa

Organism

Homo sapiens (Human)

Target Sequence

LHLRSETSTFETPLGAKTLPEDEETPEQEMEETPCRELEEEEEWGSGSEDASKKDGAVESISVPDMVDKNLTCPEEEDTVKVVGIPGC

Tag

N-terminal 6xHis-GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

41.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Ubiquitin-fold modifier-conjugating enzyme 1, UFC1 ELISA Kit
MBS9337111-01 48 Well

Human Ubiquitin-fold modifier-conjugating enzyme 1, UFC1 ELISA Kit

Sign In for Pricing
View Details
Human Ubiquitin-fold modifier-conjugating enzyme 1, UFC1 ELISA Kit
MBS9337111-02 96 Well

Human Ubiquitin-fold modifier-conjugating enzyme 1, UFC1 ELISA Kit

Sign In for Pricing
View Details
Human Ubiquitin-fold modifier-conjugating enzyme 1, UFC1 ELISA Kit
MBS9337111-03 5x 96 Well

Human Ubiquitin-fold modifier-conjugating enzyme 1, UFC1 ELISA Kit

Sign In for Pricing
View Details
Human Ubiquitin-fold modifier-conjugating enzyme 1, UFC1 ELISA Kit
MBS9337111-04 10x 96 Well

Human Ubiquitin-fold modifier-conjugating enzyme 1, UFC1 ELISA Kit

Sign In for Pricing
View Details
Connexin 46 (Cx46, Gap Junction Alpha 3 Protein, CXA-3) (APC)
MBS6470201-01 0.1 mL

Connexin 46 (Cx46, Gap Junction Alpha 3 Protein, CXA-3) (APC)

Sign In for Pricing
View Details
Connexin 46 (Cx46, Gap Junction Alpha 3 Protein, CXA-3) (APC)
MBS6470201-02 5x 0.1 mL

Connexin 46 (Cx46, Gap Junction Alpha 3 Protein, CXA-3) (APC)

Sign In for Pricing
View Details