Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANTES/CCL5, Human (HEK293)

RANTES/CCL5 Protein, Human (HEK293) is a key pro-inflammatory chemokine in the CC chemokine family that interacts with CCR1, CCR3, CCR4, and CCR5 to mediate inflammatory immune responses, viral infections, and tumorigenesis. RANTES/CCL5 Protein, Human (HEK293) is a recombinant human RANTES/CCL5 (S24-S91) protein expressed by HEK293[1].

Product Specifications

Product Name Alternative

RANTES/CCL5 Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rantes-ccl5-protein-human-hek293.html

Purity

98.00

Smiles

SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS

Molecular Formula

6352 (Gene_ID) P13501 (S24-S91) (Accession)

Molecular Weight

Approximately 8 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]V Appay, et al. RANTES: a versatile and controversial chemokine. Trends Immunol. 2001 Feb;22 (2) :83-7.|[2]Zhen Zeng, et al. CCL5/CCR5 axis in human diseases and related treatments. Genes Dis. 2022 Jan;9 (1) :12-27.|[3]F Cocchi, et al. Identification of RANTES, MIP-1 alpha, and MIP-1 beta as the major HIV-suppressive factors produced by CD8+ T cells. Science. 1995 Dec 15;270 (5243) :1811-5.|[4]Shih-Wei Wang, et al. CCL5 and CCR5 interaction promotes cell motility in human osteosarcoma. PLoS One. 2012;7 (4) :e35101.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pop Up Rack Green 50ml_
RAC3118 2 / PCK

Pop Up Rack Green 50ml_

Sign In for Pricing
View Details
Recombinant Shewanella baltica Transcriptional repressor NrdR (nrdR)
MBS1132869-01 0.02 mg (E-Coli)

Recombinant Shewanella baltica Transcriptional repressor NrdR (nrdR)

Sign In for Pricing
View Details
Recombinant Shewanella baltica Transcriptional repressor NrdR (nrdR)
MBS1132869-02 0.1 mg (E-Coli)

Recombinant Shewanella baltica Transcriptional repressor NrdR (nrdR)

Sign In for Pricing
View Details
Recombinant Shewanella baltica Transcriptional repressor NrdR (nrdR)
MBS1132869-03 0.02 mg (Yeast)

Recombinant Shewanella baltica Transcriptional repressor NrdR (nrdR)

Sign In for Pricing
View Details
Recombinant Shewanella baltica Transcriptional repressor NrdR (nrdR)
MBS1132869-04 0.1 mg (Yeast)

Recombinant Shewanella baltica Transcriptional repressor NrdR (nrdR)

Sign In for Pricing
View Details
Recombinant Shewanella baltica Transcriptional repressor NrdR (nrdR)
MBS1132869-05 0.02 mg (Baculovirus)

Recombinant Shewanella baltica Transcriptional repressor NrdR (nrdR)

Sign In for Pricing
View Details