Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Tumor necrosis factor ligand superfamily member 4 (TNFSF4), partial

Product Specifications

Product Name Alternative

OX40 ligand; OX40L; CD252

Abbreviation

Recombinant Rabbit TNFSF4 protein, partial

Gene Name

TNFSF4

UniProt

O02765

Expression Region

45-187aa

Organism

Oryctolagus cuniculus (Rabbit)

Target Sequence

QHSHAPEVSLQYPPIENIMTQLQILTSHECEEDSFILPLQKRDGTMEVQNNSVVIQCDGFYLLSLKGYFSQEVSISLHYRKGEEPFPILKKTKFANSNVVLKLGYKDKVYLNVTTDSASCKQLSVNAGELIVILQNPGGYCAP

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

Baculovirus

Field of Research

Immunology

Relevance

Cytokine that binds to TNFRSF4. Co-stimulates T-cell proliferation and cytokine production.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.9 kDa

References & Citations

"Expression of OX40 and OX40 ligand genes in rabbit HTLV-I-transformed T cell lines." Isono T., Seto A. Submitted (MAY-1997) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA].

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRNAC17 sgRNA CRISPR Lentivector (Human) (Target 2)
K2478403 1.0 µg DNA

TRNAC17 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
BGLAP/Osteocalcin Rabbit Polyclonal Antibody
AF6297 50 µL

BGLAP/Osteocalcin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD21 / CD35 Monoclonal Antibody
ANT-10931-50ug 50 µg

CD21 / CD35 Monoclonal Antibody

Sign In for Pricing
View Details
HS3ST3A1 (NM_006042) Human Untagged Clone
SC319867 10 µg

HS3ST3A1 (NM_006042) Human Untagged Clone

Sign In for Pricing
View Details
Fgg (NM_012559) Rat Tagged ORF Clone Lentiviral Particle
RR206016L3V 200 µL

Fgg (NM_012559) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse Vmn2r74 qPCR Primer Pair
QM75778S 200 Tests

Mouse Vmn2r74 qPCR Primer Pair

Sign In for Pricing
View Details