Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CBS, Human (His)

CBS, a hydro-lyase, initiates the transsulfuration pathway by catalyzing the beta-replacement reaction, converting L-serine to L-cystathionine using L-homocysteine. This process eliminates L-methionine and the potentially harmful metabolite L-homocysteine. CBS, beyond its catabolic role, contributes to hydrogen sulfide production, serving as a gasotransmitter with signaling and cytoprotective effects, particularly on neurons. CBS Protein, Human (His) is the recombinant human-derived CBS protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

CBS Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cbs-protein-human-his.html

Purity

95.00

Smiles

PSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFVAAQERDQK

Molecular Formula

875 (Gene_ID) P35520 (P2-K551) (Accession)

Molecular Weight

Approximately 62 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IQCF6 (NM_001143833) Human Over-expression Lysate
LY428376 100 µg

IQCF6 (NM_001143833) Human Over-expression Lysate

Sign In for Pricing
View Details
Potassium Ethoxide (>85%)
TRC-P589460-500MG 500 mg

Potassium Ethoxide (>85%)

Sign In for Pricing
View Details
RPRmL (NM_203400) Human Over-expression Lysate
LC404339 20 µg

RPRmL (NM_203400) Human Over-expression Lysate

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse CD119 Antibody[GR-20]
E-AB-F11150-01 100 µg

AF/LE Purified Anti-Mouse CD119 Antibody[GR-20]

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse CD119 Antibody[GR-20]
E-AB-F11150-02 1 mg

AF/LE Purified Anti-Mouse CD119 Antibody[GR-20]

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse CD119 Antibody[GR-20]
E-AB-F11150-03 5 mg

AF/LE Purified Anti-Mouse CD119 Antibody[GR-20]

Sign In for Pricing
View Details