Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CBS, Human (His)

CBS, a hydro-lyase, initiates the transsulfuration pathway by catalyzing the beta-replacement reaction, converting L-serine to L-cystathionine using L-homocysteine. This process eliminates L-methionine and the potentially harmful metabolite L-homocysteine. CBS, beyond its catabolic role, contributes to hydrogen sulfide production, serving as a gasotransmitter with signaling and cytoprotective effects, particularly on neurons. CBS Protein, Human (His) is the recombinant human-derived CBS protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

CBS Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cbs-protein-human-his.html

Purity

95.00

Smiles

PSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFVAAQERDQK

Molecular Formula

875 (Gene_ID) P35520 (P2-K551) (Accession)

Molecular Weight

Approximately 62 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG Immunoglobulin (IG217), CF568 conjugate, 0.1mg/mL
BNC680217-500 1x 500 µL

Human IgG Immunoglobulin (IG217), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Ovary: left
CR559745 5 µg

Tissue Total RNA, Ovary: left

Sign In for Pricing
View Details
Myosin Phosphatase (PPP1R12A) Rabbit Polyclonal Antibody
TA380234 100 µL

Myosin Phosphatase (PPP1R12A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ADRM1 Polyclonal Antibody
E-AB-52740-01 20 µL

ADRM1 Polyclonal Antibody

Sign In for Pricing
View Details
ADRM1 Polyclonal Antibody
E-AB-52740-02 60 µL

ADRM1 Polyclonal Antibody

Sign In for Pricing
View Details
ADRM1 Polyclonal Antibody
E-AB-52740-03 120 µL

ADRM1 Polyclonal Antibody

Sign In for Pricing
View Details