Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CBS, Human (His)

CBS, a hydro-lyase, initiates the transsulfuration pathway by catalyzing the beta-replacement reaction, converting L-serine to L-cystathionine using L-homocysteine. This process eliminates L-methionine and the potentially harmful metabolite L-homocysteine. CBS, beyond its catabolic role, contributes to hydrogen sulfide production, serving as a gasotransmitter with signaling and cytoprotective effects, particularly on neurons. CBS Protein, Human (His) is the recombinant human-derived CBS protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

CBS Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cbs-protein-human-his.html

Purity

95.00

Smiles

PSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFVAAQERDQK

Molecular Formula

875 (Gene_ID) P35520 (P2-K551) (Accession)

Molecular Weight

Approximately 62 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protein Kinase D2 (PRKD2) Rabbit Polyclonal Antibody
AP06570PU-N 100 µg

Protein Kinase D2 (PRKD2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS804109 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
Epichlorohydrin-d5
TRC-E582302-1G 1 g

Epichlorohydrin-d5

Sign In for Pricing
View Details
Recombinant Human Frizzled-10/FZD10 Protein (His Tag)
PKSH030507 100 µg

Recombinant Human Frizzled-10/FZD10 Protein (His Tag)

Sign In for Pricing
View Details
Psmd14 Mouse Gene Knockout Kit (CRISPR)
KN514120 1 Kit

Psmd14 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Phospho-CDC37 (S13) Recombinant Rabbit Monoclonal Antibody [SD08-50]
ET1612-74 100 µL

Phospho-CDC37 (S13) Recombinant Rabbit Monoclonal Antibody [SD08-50]

Sign In for Pricing
View Details