Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CBS, Human (His)

CBS, a hydro-lyase, initiates the transsulfuration pathway by catalyzing the beta-replacement reaction, converting L-serine to L-cystathionine using L-homocysteine. This process eliminates L-methionine and the potentially harmful metabolite L-homocysteine. CBS, beyond its catabolic role, contributes to hydrogen sulfide production, serving as a gasotransmitter with signaling and cytoprotective effects, particularly on neurons. CBS Protein, Human (His) is the recombinant human-derived CBS protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

CBS Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cbs-protein-human-his.html

Purity

95.00

Smiles

PSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFVAAQERDQK

Molecular Formula

875 (Gene_ID) P35520 (P2-K551) (Accession)

Molecular Weight

Approximately 62 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Heme oxygenase 2 (HMOX2) (NM_002134) Human Over-expression Lysate
LY419512 100 µg

Heme oxygenase 2 (HMOX2) (NM_002134) Human Over-expression Lysate

Sign In for Pricing
View Details
Bcl-X (Apoptosis Marker) (BCL2L1/2406), CF647 conjugate, 0.1mg/mL
BNC472406-100 1x 100 µL

Bcl-X (Apoptosis Marker) (BCL2L1/2406), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1-Naphthylamine
TRC-N378015-25G 25 g

1-Naphthylamine

Sign In for Pricing
View Details
Rps25 Mouse Gene Knockout Kit (CRISPR)
KN515094 1 Kit

Rps25 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Spectrin Alpha 1 (Erythrocyte Marker) (SPTA1/2939R), CF647 conjugate, 0.1mg/mL
BNC472939-500 1x 500 µL

Spectrin Alpha 1 (Erythrocyte Marker) (SPTA1/2939R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ALAD (NM_000031) Human Over-expression Lysate
LY424965 100 µg

ALAD (NM_000031) Human Over-expression Lysate

Sign In for Pricing
View Details