Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CBS, Human (His)

CBS, a hydro-lyase, initiates the transsulfuration pathway by catalyzing the beta-replacement reaction, converting L-serine to L-cystathionine using L-homocysteine. This process eliminates L-methionine and the potentially harmful metabolite L-homocysteine. CBS, beyond its catabolic role, contributes to hydrogen sulfide production, serving as a gasotransmitter with signaling and cytoprotective effects, particularly on neurons. CBS Protein, Human (His) is the recombinant human-derived CBS protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

CBS Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cbs-protein-human-his.html

Purity

95.00

Smiles

PSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFVAAQERDQK

Molecular Formula

875 (Gene_ID) P35520 (P2-K551) (Accession)

Molecular Weight

Approximately 62 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C1orf105 activation kit by CRISPRa
GA114210 1 Kit

Human C1orf105 activation kit by CRISPRa

Sign In for Pricing
View Details
CD66 (CEA) (COL-1), 1mg/mL
BNUM0002-50 1x 50 µL

CD66 (CEA) (COL-1), 1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Metastasis, unknown source
CS801473 5x 5 µm

Tissue FFPE Sections, Metastasis, unknown source

Sign In for Pricing
View Details
Mouse Fshb activation kit by CRISPRa
GA201476 1 Kit

Mouse Fshb activation kit by CRISPRa

Sign In for Pricing
View Details
CD11c (HC1/1), CF568 conjugate, 0.1mg/mL
BNC680152-500 1x 500 µL

CD11c (HC1/1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
STK36 Antibody
8C18543-AAT 50 µg

STK36 Antibody

Sign In for Pricing
View Details