Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RGMB, Mouse (HEK293, His)

RGMB, a member of the RGM family, shapes the developing nervous system as a BMP coreceptor. It enhances BMP signaling and modulates neuronal adhesion. RGMB forms homooligomers and interacts with DRGX, BMP2, BMP4, ACVR1, BMPR1A, BMPR1B, and ACVR2B. It also forms a functional complex with NEO1/neogenin, activating downstream signaling via RhoA. RGMB Protein, Mouse (HEK293, His) is the recombinant mouse-derived RGMB protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

RGMB Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rgmb-protein-mouse-hek293-his.html

Purity

95.00

Smiles

GDCQQPTQCRIQKCTTDFVALTAHLNSAADGFDSEFCKALRAYAGCTQRTSKACRGNLVYHSAVLGISDLMSQRNCSKDGPTSSTNPEVTHDPCNYHSHGGVREHGGGDQRPPNYLFCGLFGDPHLRTFKDHFQTCKVEGAWPLIDNNYLSVQVTNVPVVPGSSATATNKVTIIFKAQHECTDQKVYQAVTDDLPAAFVDGTTSGGDGDVKSLHIVEKESGRYVEMHARYIGTTVFVRQLGRYLTLAIRMPEDLAMSYEESQDLQLCVNGCPMSECIDDGQGQVSAILGHSLPHTTSVQAWPGYTLETASTQCHEKMPVKDIYFQSCVFDLLTTGDANFTAAAHSALEDVEALHPRKERWHIFPSSC

Molecular Formula

68799 (Gene_ID) Q7TQ33/NP_848730.2 (G49-C415) (Accession)

Molecular Weight

Approximately 40.2 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lipin 1 (LPIN1) Mouse Monoclonal Antibody [Clone ID: OTI1B7]
CF805973 100 µg

Lipin 1 (LPIN1) Mouse Monoclonal Antibody [Clone ID: OTI1B7]

Sign In for Pricing
View Details
Hexanoic-6,6,6-d3 Acid
TRC-H292147-5MG 5 mg

Hexanoic-6,6,6-d3 Acid

Sign In for Pricing
View Details
Human Angiotensin II (AngII) ELISA Kit
RD-AngII-Hu-01 96 Tests

Human Angiotensin II (AngII) ELISA Kit

Sign In for Pricing
View Details
Human Angiotensin II (AngII) ELISA Kit
RD-AngII-Hu-02 48 Tests

Human Angiotensin II (AngII) ELISA Kit

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS706519 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
CDV3 (NM_001134422) Human Over-expression Lysate
LY427429 100 µg

CDV3 (NM_001134422) Human Over-expression Lysate

Sign In for Pricing
View Details