Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RGMB, Mouse (HEK293, His)

RGMB, a member of the RGM family, shapes the developing nervous system as a BMP coreceptor. It enhances BMP signaling and modulates neuronal adhesion. RGMB forms homooligomers and interacts with DRGX, BMP2, BMP4, ACVR1, BMPR1A, BMPR1B, and ACVR2B. It also forms a functional complex with NEO1/neogenin, activating downstream signaling via RhoA. RGMB Protein, Mouse (HEK293, His) is the recombinant mouse-derived RGMB protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

RGMB Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rgmb-protein-mouse-hek293-his.html

Purity

95.00

Smiles

GDCQQPTQCRIQKCTTDFVALTAHLNSAADGFDSEFCKALRAYAGCTQRTSKACRGNLVYHSAVLGISDLMSQRNCSKDGPTSSTNPEVTHDPCNYHSHGGVREHGGGDQRPPNYLFCGLFGDPHLRTFKDHFQTCKVEGAWPLIDNNYLSVQVTNVPVVPGSSATATNKVTIIFKAQHECTDQKVYQAVTDDLPAAFVDGTTSGGDGDVKSLHIVEKESGRYVEMHARYIGTTVFVRQLGRYLTLAIRMPEDLAMSYEESQDLQLCVNGCPMSECIDDGQGQVSAILGHSLPHTTSVQAWPGYTLETASTQCHEKMPVKDIYFQSCVFDLLTTGDANFTAAAHSALEDVEALHPRKERWHIFPSSC

Molecular Formula

68799 (Gene_ID) Q7TQ33/NP_848730.2 (G49-C415) (Accession)

Molecular Weight

Approximately 40.2 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cenpm (BC009160) Mouse Tagged ORF Clone
MG201638 10 µg

Cenpm (BC009160) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Cytochrome P450 17A1 (CYP17A1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5G10]
TA503415AM 100 µL

Cytochrome P450 17A1 (CYP17A1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5G10]

Sign In for Pricing
View Details
Dihydrolysergic Acid
TRC-D448795-25MG 25 mg

Dihydrolysergic Acid

Sign In for Pricing
View Details
EGFR (Extracell. Dom.) (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 20E12]
AM00046PU-N 100 µg

EGFR (Extracell. Dom.) (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 20E12]

Sign In for Pricing
View Details
Caffeic Acid
TRC-C080000-50MG 50 mg

Caffeic Acid

Sign In for Pricing
View Details
Urea-13C
TRC-U822503-1G 1 g

Urea-13C

Sign In for Pricing
View Details