Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSAT1, Human (His)

The PSAT1 protein plays a central role in cellular metabolism by catalyzing the reversible conversion of 3-phosphohydroxypyruvate to phosphoserine and 3-hydroxy-2-oxo-4-phosphonooxybutyrate to phosphohydroxythreonine. These enzyme activities are key steps in the biosynthetic pathway of the essential amino acids serine and threonine. PSAT1 Protein, Human (His) is the recombinant human-derived PSAT1 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PSAT1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/psat1-protein-human-his.html

Purity

96.00

Smiles

MDAPRQVVNFGPGPAKLPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFAKIINNTENLVRELLAVPDNYKVIFLQGGGCGQFSAVPLNLIGLKAGRCADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASYVYYCANETVHGVEFDFIPDVKGAVLVCDMSSNFLSKPVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFALRECPSVLEYKVQAGNSSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPVEPQNRSKMNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASLYNAVTIEDVQKLAAFMKKFLEMHQL

Molecular Formula

29968 (Gene_ID) Q9Y617-1 (M1-L370) (Accession)

Molecular Weight

Approximately 40 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal mGluR6 Antibody [mFluor Violet 450 SE]
NB300-189MFV450 0.1 mL

Rabbit Polyclonal mGluR6 Antibody [mFluor Violet 450 SE]

Sign In for Pricing
View Details
SRGN 3'UTR GFP Stable Cell Line
TU074587 1.0 mL

SRGN 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
HEF1 Antibody (Human, Mouse, Rat)
B2024235 100 µg

HEF1 Antibody (Human, Mouse, Rat)

Sign In for Pricing
View Details
Rabbit Polyclonal TSEN34 Antibody [DyLight 650]
NBP2-98554C 0.1 mL

Rabbit Polyclonal TSEN34 Antibody [DyLight 650]

Sign In for Pricing
View Details
Rabbit Monoclonal Carbonic Anhydrase XIV/CA14 Antibody (033) [mFluor Violet 450 SE]
NBP2-90349MFV450 0.1 mL

Rabbit Monoclonal Carbonic Anhydrase XIV/CA14 Antibody (033) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Transmembrane Protein 121B Rabbit pAb
E2163424 100 µL

Transmembrane Protein 121B Rabbit pAb

Sign In for Pricing
View Details