Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSAT1, Human (His)

The PSAT1 protein plays a central role in cellular metabolism by catalyzing the reversible conversion of 3-phosphohydroxypyruvate to phosphoserine and 3-hydroxy-2-oxo-4-phosphonooxybutyrate to phosphohydroxythreonine. These enzyme activities are key steps in the biosynthetic pathway of the essential amino acids serine and threonine. PSAT1 Protein, Human (His) is the recombinant human-derived PSAT1 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PSAT1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/psat1-protein-human-his.html

Purity

96.00

Smiles

MDAPRQVVNFGPGPAKLPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFAKIINNTENLVRELLAVPDNYKVIFLQGGGCGQFSAVPLNLIGLKAGRCADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASYVYYCANETVHGVEFDFIPDVKGAVLVCDMSSNFLSKPVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFALRECPSVLEYKVQAGNSSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPVEPQNRSKMNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASLYNAVTIEDVQKLAAFMKKFLEMHQL

Molecular Formula

29968 (Gene_ID) Q9Y617-1 (M1-L370) (Accession)

Molecular Weight

Approximately 40 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NOL8 activation kit by CRISPRa
GA110470 1 Kit

Human NOL8 activation kit by CRISPRa

Sign In for Pricing
View Details
Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2123R), Biotin conjugate, 0.1mg/mL
BNCB2123-500 1x 500 µL

Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2123R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
4',5,7-Trihydroxyisoflavone 4’,5’-Diacetate 7’-Sulfate Pyridinium Salt
TRC-T795280-10MG 10 mg

4',5,7-Trihydroxyisoflavone 4’,5’-Diacetate 7’-Sulfate Pyridinium Salt

Sign In for Pricing
View Details
S100A4 / Metastasin / Calvasculin (Marker of Tumor Metastasis) (CPTC-S100A4-3), CF568 conjugate, 0.1mg/mL
BNC682224-100 1x 100 µL

S100A4 / Metastasin / Calvasculin (Marker of Tumor Metastasis) (CPTC-S100A4-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Spaca4 (NM_027055) Mouse Tagged ORF Clone
MG200683 10 µg

Spaca4 (NM_027055) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
4-tert-Butylphenethanol
TRC-B540680-1G 1 g

4-tert-Butylphenethanol

Sign In for Pricing
View Details