Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSAT1, Human (His)

The PSAT1 protein plays a central role in cellular metabolism by catalyzing the reversible conversion of 3-phosphohydroxypyruvate to phosphoserine and 3-hydroxy-2-oxo-4-phosphonooxybutyrate to phosphohydroxythreonine. These enzyme activities are key steps in the biosynthetic pathway of the essential amino acids serine and threonine. PSAT1 Protein, Human (His) is the recombinant human-derived PSAT1 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PSAT1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/psat1-protein-human-his.html

Purity

96.00

Smiles

MDAPRQVVNFGPGPAKLPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFAKIINNTENLVRELLAVPDNYKVIFLQGGGCGQFSAVPLNLIGLKAGRCADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASYVYYCANETVHGVEFDFIPDVKGAVLVCDMSSNFLSKPVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFALRECPSVLEYKVQAGNSSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPVEPQNRSKMNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASLYNAVTIEDVQKLAAFMKKFLEMHQL

Molecular Formula

29968 (Gene_ID) Q9Y617-1 (M1-L370) (Accession)

Molecular Weight

Approximately 40 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spock3 Mouse qPCR Template Standard (NM_023689)
MK204510 1 Kit

Spock3 Mouse qPCR Template Standard (NM_023689)

Sign In for Pricing
View Details
PerCP/Cy5.5 Anti-human CD167a Antibody *51D6*
116701T2-AAT 500 Tests

PerCP/Cy5.5 Anti-human CD167a Antibody *51D6*

Sign In for Pricing
View Details
Frizzled 7 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-5125R-BF405 100 µL

Frizzled 7 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Phthalylsulfathiazole
TRC-P397503-5G 5 g

Phthalylsulfathiazole

Sign In for Pricing
View Details
Human Long acting thyroid stimulator, LATS ELISA Kit
MBS9303412-01 48 Well

Human Long acting thyroid stimulator, LATS ELISA Kit

Sign In for Pricing
View Details
Human Long acting thyroid stimulator, LATS ELISA Kit
MBS9303412-02 96 Well

Human Long acting thyroid stimulator, LATS ELISA Kit

Sign In for Pricing
View Details