Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSAT1, Human (His)

The PSAT1 protein plays a central role in cellular metabolism by catalyzing the reversible conversion of 3-phosphohydroxypyruvate to phosphoserine and 3-hydroxy-2-oxo-4-phosphonooxybutyrate to phosphohydroxythreonine. These enzyme activities are key steps in the biosynthetic pathway of the essential amino acids serine and threonine. PSAT1 Protein, Human (His) is the recombinant human-derived PSAT1 protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

PSAT1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/psat1-protein-human-his.html

Purity

96.00

Smiles

MDAPRQVVNFGPGPAKLPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFAKIINNTENLVRELLAVPDNYKVIFLQGGGCGQFSAVPLNLIGLKAGRCADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASYVYYCANETVHGVEFDFIPDVKGAVLVCDMSSNFLSKPVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFALRECPSVLEYKVQAGNSSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPVEPQNRSKMNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASLYNAVTIEDVQKLAAFMKKFLEMHQL

Molecular Formula

29968 (Gene_ID) Q9Y617-1 (M1-L370) (Accession)

Molecular Weight

Approximately 40 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nkx2.6 Rabbit Polyclonal Antibody (FITC)
orb222436 100 µL

Nkx2.6 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
MLH1 Antibody
E90254 100 µL

MLH1 Antibody

Sign In for Pricing
View Details
Aprataxin and PNK-like factor
AP89348 1 mg

Aprataxin and PNK-like factor

Sign In for Pricing
View Details
Natural Killer Cells Induction Culture Kit 2.0
6813531 3 L/Kit

Natural Killer Cells Induction Culture Kit 2.0

Sign In for Pricing
View Details
Lentiviral human HERPUD2 shRNA (UAS) - Lentiviral human HERPUD2 shRNA (UAS) (100)
GTR15330621 1 Vial

Lentiviral human HERPUD2 shRNA (UAS) - Lentiviral human HERPUD2 shRNA (UAS) (100)

Sign In for Pricing
View Details
Zdhhc9 Rat shRNA Plasmid (Locus ID 302808)
TR703603 1 Kit

Zdhhc9 Rat shRNA Plasmid (Locus ID 302808)

Sign In for Pricing
View Details