Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Creatine kinase M-type/CKM, Mouse (His)

CKM is a creatine kinase M-type protein that centrally catalyzes reversible phosphate transfer between ATP and various phosphogens, especially creatine phosphate. As a creatine kinase isoenzyme, CKM plays a crucial role in energy transduction, particularly in tissues with large and fluctuating energy demands, such as skeletal muscle, heart, brain, and sperm. Creatine kinase M-type/CKM Protein, Mouse (His) is the recombinant mouse-derived Creatine kinase M-type/CKM protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Creatine kinase M-type/CKM Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/creatine-kinase-m-type-ckm-protein-mouse-his.html

Purity

94.00

Smiles

MPFGNTHNKFKLNYKPQEEYPDLSKHNNHMAKVLTPDLYNKLRDKETPSGFTLDDVIQTGVDNPGHPFIMTVGCVAGDEESYTVFKDLFDPIIQDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEQEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNEHLGYVLTCPSNLGTGLRGGVHVKLANLSKHPKFEEILTRLRLQKRGTGGVDTAAVGAVFDISNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK

Molecular Formula

12715 (Gene_ID) P07310 (M1-K381) (Accession)

Molecular Weight

49.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TXNRD2 Recombinant Rabbit Monoclonal Antibody [PSH02-27]
HA721807 100 µL

TXNRD2 Recombinant Rabbit Monoclonal Antibody [PSH02-27]

Sign In for Pricing
View Details
CD79a (JCB117 + HM47/A9), Biotin conjugate, 0.1mg/mL
BNCB0828-500 1x 500 µL

CD79a (JCB117 + HM47/A9), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DNAAF6 (NM_173494) Human Recombinant Protein
TP306739M 100 µg

DNAAF6 (NM_173494) Human Recombinant Protein

Sign In for Pricing
View Details
Fxyd3 (BC051033) Mouse Tagged ORF Clone
MG200072 10 µg

Fxyd3 (BC051033) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
RAB25 (Center) Rabbit Polyclonal Antibody
AP53540PU-N 400 µL

RAB25 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Uncoated Human BMG/β2-MG (Beta-2-Microglobulin) ELISA Kit
E-UNEL-H0005-01 5x 96 Tests

Uncoated Human BMG/β2-MG (Beta-2-Microglobulin) ELISA Kit

Sign In for Pricing
View Details