Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Creatine kinase M-type/CKM, Mouse (His)

CKM is a creatine kinase M-type protein that centrally catalyzes reversible phosphate transfer between ATP and various phosphogens, especially creatine phosphate. As a creatine kinase isoenzyme, CKM plays a crucial role in energy transduction, particularly in tissues with large and fluctuating energy demands, such as skeletal muscle, heart, brain, and sperm. Creatine kinase M-type/CKM Protein, Mouse (His) is the recombinant mouse-derived Creatine kinase M-type/CKM protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Creatine kinase M-type/CKM Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/creatine-kinase-m-type-ckm-protein-mouse-his.html

Purity

94.00

Smiles

MPFGNTHNKFKLNYKPQEEYPDLSKHNNHMAKVLTPDLYNKLRDKETPSGFTLDDVIQTGVDNPGHPFIMTVGCVAGDEESYTVFKDLFDPIIQDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEQEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNEHLGYVLTCPSNLGTGLRGGVHVKLANLSKHPKFEEILTRLRLQKRGTGGVDTAAVGAVFDISNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK

Molecular Formula

12715 (Gene_ID) P07310 (M1-K381) (Accession)

Molecular Weight

49.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD100 Recombinant Rabbit Monoclonal Antibody [JE63-21]
HA721013 100 µL

CD100 Recombinant Rabbit Monoclonal Antibody [JE63-21]

Sign In for Pricing
View Details
Lumateperone N-Oxide
TRC-L753880-50MG 50 mg

Lumateperone N-Oxide

Sign In for Pricing
View Details
EGFR pTyr1172 Rabbit Polyclonal Antibody
AP20828PU-N 100 µg

EGFR pTyr1172 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Bcl-2 (100/D5 + 124), CF568 conjugate, 0.1mg/mL
BNC681234-100 1x 100 µL

Bcl-2 (100/D5 + 124), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fluoranthene-d10
TRC-F461992-25MG 25 mg

Fluoranthene-d10

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Human T Cell T6,  30nm
GM-20-30 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Human T Cell T6, 30nm

Sign In for Pricing
View Details