CEACAM3, Human (His-SUMO)
The CEACAM3 protein is a key granulocyte receptor that effectively orchestrates the opsonin-independent phagocytosis of CEACAM-bound microorganisms such as Neisseria spp., Moraxella spp., and Haemophilus spp. This role places CEACAM3 at the forefront of pathogen clearance in the innate immune system. CEACAM3 Protein, Human (His-SUMO) is the recombinant human-derived CEACAM3 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.
Product Specifications
Product Name Alternative
CEACAM3 Protein, Human (His-SUMO), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ceacam3-protein-human-his-sumo.html
Smiles
KLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAG
Molecular Formula
1084 (Gene_ID) P40198 (K35-G155) (Accession)
Molecular Weight
Approximately 29.1 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
KRAS, CT (KRAS, KRAS2, RASK2, GTPase KRas, K-Ras 2, Ki-Ras, c-K-ras, c-Ki-ras, GTPase KRas, N-terminally processed) (MaxLight 650) discontinued
Allograft Inflammatory Factor 1 Isoforms 1 and 3 (AIF1 Isoforms 1 + 3) Antibody (Biotin)
