Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-10, Rat (CHO)

IL-10 Protein, Rat (CHO) is a CHO cell derived immunosuppressive cytokine produced by a variety of mammalian cell types including macophages, monocytes, B-cells, T-cells and keratinocytes.

Product Specifications

Product Name Alternative

IL-10 Protein, Rat (CHO), Rat, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-10-protein-rat-cho.html

Purity

95.00

Smiles

SKGHSIRGDNNCTHFPVSQTHMLRELRAAFSQVKTFFQKKDQLDNILLTDSLLQDFKGYLGCQALSEMIKFYLVEVMPQAENHGPEIKEHLNSLGEKLKTLWIQLRRCHRFLPCENKSKAVEQVKNDFNKLQDKGVYKAMNEFDIFINCIEAYVTLKMKN

Molecular Formula

25325 (Gene_ID) P29456 (S19-N178) (Accession)

Molecular Weight

Approximately 8-22 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Ball C, et al. Rat interleukin-10: production and characterisation of biologically active protein in a recombinantbacterial expression system. Eur Cytokine Netw. 2001 Mar;12 (1) :187-93.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Forced Convection Oven BOFC-5401
BOFC-5401 1 Unit

Forced Convection Oven BOFC-5401

Sign In for Pricing
View Details
NAPSIN A (NAPSA) (N-term) Mouse Monoclonal Antibody [Clone ID: KCG1.1]
AM03172PU-N 1 mL

NAPSIN A (NAPSA) (N-term) Mouse Monoclonal Antibody [Clone ID: KCG1.1]

Sign In for Pricing
View Details
1,2-Benzisoxazol-3-ylacetic Acid
TRC-B201960-250MG 250 mg

1,2-Benzisoxazol-3-ylacetic Acid

Sign In for Pricing
View Details
LAMP2 Human Gene Knockout Kit (CRISPR)
KN200456 1 Kit

LAMP2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Coelenterazine N
#10115-2 1x 250 µg

Coelenterazine N

Sign In for Pricing
View Details
LIMK2 Recombinant Rabbit monoclonal Antibody
HA751247 100 µL

LIMK2 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details