IL-10, Rat (CHO)
IL-10 Protein, Rat (CHO) is a CHO cell derived immunosuppressive cytokine produced by a variety of mammalian cell types including macophages, monocytes, B-cells, T-cells and keratinocytes.
Product Specifications
Product Name Alternative
IL-10 Protein, Rat (CHO), Rat, CHO
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/il-10-protein-rat-cho.html
Purity
95.00
Smiles
SKGHSIRGDNNCTHFPVSQTHMLRELRAAFSQVKTFFQKKDQLDNILLTDSLLQDFKGYLGCQALSEMIKFYLVEVMPQAENHGPEIKEHLNSLGEKLKTLWIQLRRCHRFLPCENKSKAVEQVKNDFNKLQDKGVYKAMNEFDIFINCIEAYVTLKMKN
Molecular Formula
25325 (Gene_ID) P29456 (S19-N178) (Accession)
Molecular Weight
Approximately 8-22 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
References & Citations
[1]Ball C, et al. Rat interleukin-10: production and characterisation of biologically active protein in a recombinantbacterial expression system. Eur Cytokine Netw. 2001 Mar;12 (1) :187-93.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB2267-500 1x 500 µL
Cell Division Cycle 34 homolog (CPTC-CDC34-2), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
TP325152M 100 µg
HRASLS3 (PLA2G16) (NM_001128203) Human Recombinant Protein
Sign In for Pricing
View Details 