Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-10, Rat (CHO)

IL-10 Protein, Rat (CHO) is a CHO cell derived immunosuppressive cytokine produced by a variety of mammalian cell types including macophages, monocytes, B-cells, T-cells and keratinocytes.

Product Specifications

Product Name Alternative

IL-10 Protein, Rat (CHO), Rat, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-10-protein-rat-cho.html

Purity

95.00

Smiles

SKGHSIRGDNNCTHFPVSQTHMLRELRAAFSQVKTFFQKKDQLDNILLTDSLLQDFKGYLGCQALSEMIKFYLVEVMPQAENHGPEIKEHLNSLGEKLKTLWIQLRRCHRFLPCENKSKAVEQVKNDFNKLQDKGVYKAMNEFDIFINCIEAYVTLKMKN

Molecular Formula

25325 (Gene_ID) P29456 (S19-N178) (Accession)

Molecular Weight

Approximately 8-22 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Ball C, et al. Rat interleukin-10: production and characterisation of biologically active protein in a recombinantbacterial expression system. Eur Cytokine Netw. 2001 Mar;12 (1) :187-93.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRNAQ24 Protein Vector (Human) (pPM-C-His)
PV139853 500 ng

TRNAQ24 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Zebrafish TRIR Rabbit Polyclonal Antibody (HRP)
orb2899951 100 µg

Zebrafish TRIR Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
LST1 Human shRNA Plasmid Kit (Locus ID 7940)
TR311652 1 Kit

LST1 Human shRNA Plasmid Kit (Locus ID 7940)

Sign In for Pricing
View Details
Goat anti-Human IgG-Fc Fragment Cross-Adsorbed Antibody DyLight 680 Conjugated
MBS3907014-01 0.5 mg

Goat anti-Human IgG-Fc Fragment Cross-Adsorbed Antibody DyLight 680 Conjugated

Sign In for Pricing
View Details
Goat anti-Human IgG-Fc Fragment Cross-Adsorbed Antibody DyLight 680 Conjugated
MBS3907014-02 5x 0.5 mg

Goat anti-Human IgG-Fc Fragment Cross-Adsorbed Antibody DyLight 680 Conjugated

Sign In for Pricing
View Details
CACNA1B Antibody, FITC conjugated
A15763-100UL 100 µL

CACNA1B Antibody, FITC conjugated

Sign In for Pricing
View Details