Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JAM-B/CD322, Rat (HEK293, His)

Junctional adhesion molecule 2 (Jam2, Jam-B, CD322) is a member of the immunoglobulin superfamily, and the junctional adhesion molecule (JAM) family. Jam2 is a type I membrane protein that is localized at the tight junctions of both epithelial and endothelial cells. Jam2 has integrin alpha-4/beta-1 binding activity and an inhibitory somatodendritic cue. JAM-B/CD322 Protein, Rat (HEK293, His) is the recombinant rat-derived JAM-B/CD322 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

JAM-B/CD322 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/jam-b-cd322-protein-rat-hek293-his.html

Purity

95.90

Smiles

FSASKDHRQEVSVIEYQEAILACKTPKKTTSSRLEWKKLGQGVSLVYYQQALQGDFKDRAEMIDFNIRIKNVTRHDAGEYRCEVSAPTEQGQNLQEDTVMLEVLVAPAVPSCEVPTSVMSGSVVELRCQEKEGNPAPEYIWFKDGTSLLGNPKGGAHRNSSYTMNTKSGTLQFNMISKMDSGEYYCEARNSVGHRRCPGKRMQVDVLN

Molecular Formula

619374 (Gene_ID) Q3MHC0 (F29-N236) (Accession)

Molecular Weight

Approximately 30-35 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYL12B (NM_033546) Human Recombinant Protein
TP301372M 100 µg

MYL12B (NM_033546) Human Recombinant Protein

Sign In for Pricing
View Details
Isl2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6815807 1.0 µg DNA

Isl2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Recombinant Human SH3 and PX domain-containing protein 2B (SH3PXD2B) , partial
MBS953973 Inquire

Recombinant Human SH3 and PX domain-containing protein 2B (SH3PXD2B) , partial

Sign In for Pricing
View Details
PPP1R10 Peptide
DF2235-BP 1 mg

PPP1R10 Peptide

Sign In for Pricing
View Details
Mouse Interleukin-2 Antibody (Biotin)
GWB-99B70C 0.2 mg

Mouse Interleukin-2 Antibody (Biotin)

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS527514 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details