Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JAM-B/CD322, Rat (HEK293, His)

Junctional adhesion molecule 2 (Jam2, Jam-B, CD322) is a member of the immunoglobulin superfamily, and the junctional adhesion molecule (JAM) family. Jam2 is a type I membrane protein that is localized at the tight junctions of both epithelial and endothelial cells. Jam2 has integrin alpha-4/beta-1 binding activity and an inhibitory somatodendritic cue. JAM-B/CD322 Protein, Rat (HEK293, His) is the recombinant rat-derived JAM-B/CD322 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

JAM-B/CD322 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/jam-b-cd322-protein-rat-hek293-his.html

Purity

95.90

Smiles

FSASKDHRQEVSVIEYQEAILACKTPKKTTSSRLEWKKLGQGVSLVYYQQALQGDFKDRAEMIDFNIRIKNVTRHDAGEYRCEVSAPTEQGQNLQEDTVMLEVLVAPAVPSCEVPTSVMSGSVVELRCQEKEGNPAPEYIWFKDGTSLLGNPKGGAHRNSSYTMNTKSGTLQFNMISKMDSGEYYCEARNSVGHRRCPGKRMQVDVLN

Molecular Formula

619374 (Gene_ID) Q3MHC0 (F29-N236) (Accession)

Molecular Weight

Approximately 30-35 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Citrullinated LL-37 3cit
HY-P5842 1 Each

Citrullinated LL-37 3cit

Sign In for Pricing
View Details
MINPP1 (NM_004897) Human Tagged ORF Clone
RG207581 10 µg

MINPP1 (NM_004897) Human Tagged ORF Clone

Sign In for Pricing
View Details
DIO2 (h) -PR
sc-77148-PR 10 µM - 20 µL

DIO2 (h) -PR

Sign In for Pricing
View Details
MTCH2, NT (MTCH2, MIMP, Mitochondrial carrier homolog 2, Met-induced mitochondrial protein) (MaxLight 650)
MBS6322700-01 0.1 mL

MTCH2, NT (MTCH2, MIMP, Mitochondrial carrier homolog 2, Met-induced mitochondrial protein) (MaxLight 650)

Sign In for Pricing
View Details
MTCH2, NT (MTCH2, MIMP, Mitochondrial carrier homolog 2, Met-induced mitochondrial protein) (MaxLight 650)
MBS6322700-02 5x 0.1 mL

MTCH2, NT (MTCH2, MIMP, Mitochondrial carrier homolog 2, Met-induced mitochondrial protein) (MaxLight 650)

Sign In for Pricing
View Details
Mouse Monoclonal Cytochrome P450 2B1 2B2 Antibody (b/e3) [Alexa Fluor 488]
NBP2-50201AF488 0.1 mL

Mouse Monoclonal Cytochrome P450 2B1 2B2 Antibody (b/e3) [Alexa Fluor 488]

Sign In for Pricing
View Details