Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JAM-B/CD322, Rat (HEK293, His)

Junctional adhesion molecule 2 (Jam2, Jam-B, CD322) is a member of the immunoglobulin superfamily, and the junctional adhesion molecule (JAM) family. Jam2 is a type I membrane protein that is localized at the tight junctions of both epithelial and endothelial cells. Jam2 has integrin alpha-4/beta-1 binding activity and an inhibitory somatodendritic cue. JAM-B/CD322 Protein, Rat (HEK293, His) is the recombinant rat-derived JAM-B/CD322 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

JAM-B/CD322 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/jam-b-cd322-protein-rat-hek293-his.html

Purity

95.90

Smiles

FSASKDHRQEVSVIEYQEAILACKTPKKTTSSRLEWKKLGQGVSLVYYQQALQGDFKDRAEMIDFNIRIKNVTRHDAGEYRCEVSAPTEQGQNLQEDTVMLEVLVAPAVPSCEVPTSVMSGSVVELRCQEKEGNPAPEYIWFKDGTSLLGNPKGGAHRNSSYTMNTKSGTLQFNMISKMDSGEYYCEARNSVGHRRCPGKRMQVDVLN

Molecular Formula

619374 (Gene_ID) Q3MHC0 (F29-N236) (Accession)

Molecular Weight

Approximately 30-35 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human MPV17L knockout cell line
ABC-KH9456 1 Vial

Human MPV17L knockout cell line

Ask
View Details
Codon optimized Cre (iCre) and GFP Adenovirus (Ad-GFP-2A-iCre)
1772 200 µL

Codon optimized Cre (iCre) and GFP Adenovirus (Ad-GFP-2A-iCre)

Ask
View Details
Human Tomoregulin-1 (TMEFF1) Antibody
35774-05111 150 µg

Human Tomoregulin-1 (TMEFF1) Antibody

Ask
View Details
PCSK6, CT (PCSK6, PACE4, Proprotein convertase subtilisin/kexin type 6, Paired basic amino acid cleaving enzyme 4, Subtilisin-like proprotein convertase 4, Subtilisin/kexin-like protease PACE4) (Azide free) (HRP)
MBS6331873-01 0.2 mL

PCSK6, CT (PCSK6, PACE4, Proprotein convertase subtilisin/kexin type 6, Paired basic amino acid cleaving enzyme 4, Subtilisin-like proprotein convertase 4, Subtilisin/kexin-like protease PACE4) (Azide free) (HRP)

Ask
View Details
PCSK6, CT (PCSK6, PACE4, Proprotein convertase subtilisin/kexin type 6, Paired basic amino acid cleaving enzyme 4, Subtilisin-like proprotein convertase 4, Subtilisin/kexin-like protease PACE4) (Azide free) (HRP)
MBS6331873-02 5x 0.2 mL

PCSK6, CT (PCSK6, PACE4, Proprotein convertase subtilisin/kexin type 6, Paired basic amino acid cleaving enzyme 4, Subtilisin-like proprotein convertase 4, Subtilisin/kexin-like protease PACE4) (Azide free) (HRP)

Ask
View Details
FITC anti-mouse TCR γ/δ Recombinant
GT01487 100 µg

FITC anti-mouse TCR γ/δ Recombinant

Ask
View Details