Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JAM-B/CD322, Rat (HEK293, His)

Junctional adhesion molecule 2 (Jam2, Jam-B, CD322) is a member of the immunoglobulin superfamily, and the junctional adhesion molecule (JAM) family. Jam2 is a type I membrane protein that is localized at the tight junctions of both epithelial and endothelial cells. Jam2 has integrin alpha-4/beta-1 binding activity and an inhibitory somatodendritic cue. JAM-B/CD322 Protein, Rat (HEK293, His) is the recombinant rat-derived JAM-B/CD322 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

JAM-B/CD322 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/jam-b-cd322-protein-rat-hek293-his.html

Purity

95.90

Smiles

FSASKDHRQEVSVIEYQEAILACKTPKKTTSSRLEWKKLGQGVSLVYYQQALQGDFKDRAEMIDFNIRIKNVTRHDAGEYRCEVSAPTEQGQNLQEDTVMLEVLVAPAVPSCEVPTSVMSGSVVELRCQEKEGNPAPEYIWFKDGTSLLGNPKGGAHRNSSYTMNTKSGTLQFNMISKMDSGEYYCEARNSVGHRRCPGKRMQVDVLN

Molecular Formula

619374 (Gene_ID) Q3MHC0 (F29-N236) (Accession)

Molecular Weight

Approximately 30-35 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal beta-III Tubulin Antibody (TUBB3/7089R) [Alexa Fluor 647]
NBP3-14229AF647 0.1 mL

Rabbit Monoclonal beta-III Tubulin Antibody (TUBB3/7089R) [Alexa Fluor 647]

Sign In for Pricing
View Details
GTP binding protein era homolog (ERAL1) Human shRNA Plasmid Kit (Locus ID 26284)
TL313181 1 Kit

GTP binding protein era homolog (ERAL1) Human shRNA Plasmid Kit (Locus ID 26284)

Sign In for Pricing
View Details
Rreb1 (NM_001177868) Mouse Tagged ORF Clone Lentiviral Particle
MR219806L4V 200 µL

Rreb1 (NM_001177868) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
TMEM176B Recombinant Protein (Mouse)
RP179450 100 µg

TMEM176B Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Recombinant Mouse RAB17 Protein, His (Fc)-Avi-tagged
RAB17-7341M 50 µg

Recombinant Mouse RAB17 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Zfp668 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7577705 3x 1.0 µg

Zfp668 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details