Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JAM-B/CD322, Rat (HEK293, His)

Junctional adhesion molecule 2 (Jam2, Jam-B, CD322) is a member of the immunoglobulin superfamily, and the junctional adhesion molecule (JAM) family. Jam2 is a type I membrane protein that is localized at the tight junctions of both epithelial and endothelial cells. Jam2 has integrin alpha-4/beta-1 binding activity and an inhibitory somatodendritic cue. JAM-B/CD322 Protein, Rat (HEK293, His) is the recombinant rat-derived JAM-B/CD322 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

JAM-B/CD322 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/jam-b-cd322-protein-rat-hek293-his.html

Purity

95.90

Smiles

FSASKDHRQEVSVIEYQEAILACKTPKKTTSSRLEWKKLGQGVSLVYYQQALQGDFKDRAEMIDFNIRIKNVTRHDAGEYRCEVSAPTEQGQNLQEDTVMLEVLVAPAVPSCEVPTSVMSGSVVELRCQEKEGNPAPEYIWFKDGTSLLGNPKGGAHRNSSYTMNTKSGTLQFNMISKMDSGEYYCEARNSVGHRRCPGKRMQVDVLN

Molecular Formula

619374 (Gene_ID) Q3MHC0 (F29-N236) (Accession)

Molecular Weight

Approximately 30-35 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human LRRC52 Alexa Fluor 350 MAb (Clone 1037552)
FAB10260U-100UG 100 µg

Human LRRC52 Alexa Fluor 350 MAb (Clone 1037552)

Sign In for Pricing
View Details
LIMK-2 (phospho Thr505) Polyclonal Antibody
ABP50354-01 30 µL

LIMK-2 (phospho Thr505) Polyclonal Antibody

Sign In for Pricing
View Details
LIMK-2 (phospho Thr505) Polyclonal Antibody
ABP50354-02 100 µL

LIMK-2 (phospho Thr505) Polyclonal Antibody

Sign In for Pricing
View Details
LIMK-2 (phospho Thr505) Polyclonal Antibody
ABP50354-03 200 µL

LIMK-2 (phospho Thr505) Polyclonal Antibody

Sign In for Pricing
View Details
Amylin (Peptide) (APC) discontinued
A2275-54A-APC 100 µL

Amylin (Peptide) (APC) discontinued

Sign In for Pricing
View Details
Trir (NM_001105946) Rat Untagged Clone
RN213565 10 µg

Trir (NM_001105946) Rat Untagged Clone

Sign In for Pricing
View Details