Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JAM-B/CD322, Rat (HEK293, His)

Junctional adhesion molecule 2 (Jam2, Jam-B, CD322) is a member of the immunoglobulin superfamily, and the junctional adhesion molecule (JAM) family. Jam2 is a type I membrane protein that is localized at the tight junctions of both epithelial and endothelial cells. Jam2 has integrin alpha-4/beta-1 binding activity and an inhibitory somatodendritic cue. JAM-B/CD322 Protein, Rat (HEK293, His) is the recombinant rat-derived JAM-B/CD322 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

JAM-B/CD322 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/jam-b-cd322-protein-rat-hek293-his.html

Purity

95.90

Smiles

FSASKDHRQEVSVIEYQEAILACKTPKKTTSSRLEWKKLGQGVSLVYYQQALQGDFKDRAEMIDFNIRIKNVTRHDAGEYRCEVSAPTEQGQNLQEDTVMLEVLVAPAVPSCEVPTSVMSGSVVELRCQEKEGNPAPEYIWFKDGTSLLGNPKGGAHRNSSYTMNTKSGTLQFNMISKMDSGEYYCEARNSVGHRRCPGKRMQVDVLN

Molecular Formula

619374 (Gene_ID) Q3MHC0 (F29-N236) (Accession)

Molecular Weight

Approximately 30-35 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ubd (NM_023137) Mouse Untagged Clone
MC207459 10 µg

Ubd (NM_023137) Mouse Untagged Clone

Sign In for Pricing
View Details
FAM36A antibody
70R-4394 50 ug

FAM36A antibody

Sign In for Pricing
View Details
Anti-Mouse EHF/ESE-3 Monoclonal Antibody (1A145)
MBS1579565-01 0.05 mg

Anti-Mouse EHF/ESE-3 Monoclonal Antibody (1A145)

Sign In for Pricing
View Details
Anti-Mouse EHF/ESE-3 Monoclonal Antibody (1A145)
MBS1579565-02 0.1 mg

Anti-Mouse EHF/ESE-3 Monoclonal Antibody (1A145)

Sign In for Pricing
View Details
Anti-Mouse EHF/ESE-3 Monoclonal Antibody (1A145)
MBS1579565-03 5x 0.1 mg

Anti-Mouse EHF/ESE-3 Monoclonal Antibody (1A145)

Sign In for Pricing
View Details
ZFP772 Double Nickase Plasmid (m)
sc-433203-NIC 20 µg

ZFP772 Double Nickase Plasmid (m)

Sign In for Pricing
View Details