Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JAM-B/CD322, Rat (HEK293, His)

Junctional adhesion molecule 2 (Jam2, Jam-B, CD322) is a member of the immunoglobulin superfamily, and the junctional adhesion molecule (JAM) family. Jam2 is a type I membrane protein that is localized at the tight junctions of both epithelial and endothelial cells. Jam2 has integrin alpha-4/beta-1 binding activity and an inhibitory somatodendritic cue. JAM-B/CD322 Protein, Rat (HEK293, His) is the recombinant rat-derived JAM-B/CD322 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

JAM-B/CD322 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/jam-b-cd322-protein-rat-hek293-his.html

Purity

95.90

Smiles

FSASKDHRQEVSVIEYQEAILACKTPKKTTSSRLEWKKLGQGVSLVYYQQALQGDFKDRAEMIDFNIRIKNVTRHDAGEYRCEVSAPTEQGQNLQEDTVMLEVLVAPAVPSCEVPTSVMSGSVVELRCQEKEGNPAPEYIWFKDGTSLLGNPKGGAHRNSSYTMNTKSGTLQFNMISKMDSGEYYCEARNSVGHRRCPGKRMQVDVLN

Molecular Formula

619374 (Gene_ID) Q3MHC0 (F29-N236) (Accession)

Molecular Weight

Approximately 30-35 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pigment red 170
HY-D0278-01 500 mg

Pigment red 170

Sign In for Pricing
View Details
Pigment red 170
HY-D0278-02 1 g

Pigment red 170

Sign In for Pricing
View Details
Recombinant 2019-nCoV NSP10 (N-6His)
32-11311-10 10 µg

Recombinant 2019-nCoV NSP10 (N-6His)

Sign In for Pricing
View Details
Human RBM47 activation kit by CRISPRa
GA110141 1 Kit

Human RBM47 activation kit by CRISPRa

Sign In for Pricing
View Details
Rabbit Polyclonal Protocadherin beta 13 Antibody
NBP1-59213 100 µL

Rabbit Polyclonal Protocadherin beta 13 Antibody

Sign In for Pricing
View Details
SARS CoV-2 PCR kit
PCR-H731-48R 48T

SARS CoV-2 PCR kit

Sign In for Pricing
View Details