Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JAM-B/CD322, Rat (HEK293, His)

Junctional adhesion molecule 2 (Jam2, Jam-B, CD322) is a member of the immunoglobulin superfamily, and the junctional adhesion molecule (JAM) family. Jam2 is a type I membrane protein that is localized at the tight junctions of both epithelial and endothelial cells. Jam2 has integrin alpha-4/beta-1 binding activity and an inhibitory somatodendritic cue. JAM-B/CD322 Protein, Rat (HEK293, His) is the recombinant rat-derived JAM-B/CD322 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

JAM-B/CD322 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/jam-b-cd322-protein-rat-hek293-his.html

Purity

95.90

Smiles

FSASKDHRQEVSVIEYQEAILACKTPKKTTSSRLEWKKLGQGVSLVYYQQALQGDFKDRAEMIDFNIRIKNVTRHDAGEYRCEVSAPTEQGQNLQEDTVMLEVLVAPAVPSCEVPTSVMSGSVVELRCQEKEGNPAPEYIWFKDGTSLLGNPKGGAHRNSSYTMNTKSGTLQFNMISKMDSGEYYCEARNSVGHRRCPGKRMQVDVLN

Molecular Formula

619374 (Gene_ID) Q3MHC0 (F29-N236) (Accession)

Molecular Weight

Approximately 30-35 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAS2R1 3'UTR Lenti-reporter-Luc Vector
46138081 1.0 µg

TAS2R1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Brms1 (NM_134155) Mouse Tagged Lenti ORF Clone
MR203076L3 10 µg

Brms1 (NM_134155) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit Polyclonal Synaptogyrin 3 Antibody [PerCP]
NBP1-77102PCP 0.1 mL

Rabbit Polyclonal Synaptogyrin 3 Antibody [PerCP]

Sign In for Pricing
View Details
Lentiviral mouse Kif3c shRNA (UAS) - Lentiviral mouse Kif3c shRNA (UAS, iRFP) (25)
GTR15172226 1 Vial

Lentiviral mouse Kif3c shRNA (UAS) - Lentiviral mouse Kif3c shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
PGPEP1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1636506 1.0 µg DNA

PGPEP1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Rabbit anti-DC8 Antibody, Affinity Purified
MBS3901308-01 0.01 mg

Rabbit anti-DC8 Antibody, Affinity Purified

Sign In for Pricing
View Details