Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JAM-B/CD322, Rat (HEK293, His)

Junctional adhesion molecule 2 (Jam2, Jam-B, CD322) is a member of the immunoglobulin superfamily, and the junctional adhesion molecule (JAM) family. Jam2 is a type I membrane protein that is localized at the tight junctions of both epithelial and endothelial cells. Jam2 has integrin alpha-4/beta-1 binding activity and an inhibitory somatodendritic cue. JAM-B/CD322 Protein, Rat (HEK293, His) is the recombinant rat-derived JAM-B/CD322 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

JAM-B/CD322 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/jam-b-cd322-protein-rat-hek293-his.html

Purity

95.90

Smiles

FSASKDHRQEVSVIEYQEAILACKTPKKTTSSRLEWKKLGQGVSLVYYQQALQGDFKDRAEMIDFNIRIKNVTRHDAGEYRCEVSAPTEQGQNLQEDTVMLEVLVAPAVPSCEVPTSVMSGSVVELRCQEKEGNPAPEYIWFKDGTSLLGNPKGGAHRNSSYTMNTKSGTLQFNMISKMDSGEYYCEARNSVGHRRCPGKRMQVDVLN

Molecular Formula

619374 (Gene_ID) Q3MHC0 (F29-N236) (Accession)

Molecular Weight

Approximately 30-35 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse BLC Levator Ani Muscl Paraffin Sections
MP-127-BLC 10 Slides

Mouse BLC Levator Ani Muscl Paraffin Sections

Sign In for Pricing
View Details
USP3 Antibody, Biotin conjugated
A72186-100UG 100 µg

USP3 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Mouse SPTY2D1 siRNA
abx935111-01 15 nmol

Mouse SPTY2D1 siRNA

Sign In for Pricing
View Details
Mouse SPTY2D1 siRNA
abx935111-02 30 nmol

Mouse SPTY2D1 siRNA

Sign In for Pricing
View Details
Ankrd11 Rat siRNA Oligo Duplex (Locus ID 365023)
SR512844 1 Kit

Ankrd11 Rat siRNA Oligo Duplex (Locus ID 365023)

Sign In for Pricing
View Details
4.5 mL ArcticIce cryogenic tube, external thread, self-standing, internal U-bottom, 50/pack, sterile
1445-7310 50/PCK

4.5 mL ArcticIce cryogenic tube, external thread, self-standing, internal U-bottom, 50/pack, sterile

Sign In for Pricing
View Details