Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JAM-B/CD322, Rat (HEK293, His)

Junctional adhesion molecule 2 (Jam2, Jam-B, CD322) is a member of the immunoglobulin superfamily, and the junctional adhesion molecule (JAM) family. Jam2 is a type I membrane protein that is localized at the tight junctions of both epithelial and endothelial cells. Jam2 has integrin alpha-4/beta-1 binding activity and an inhibitory somatodendritic cue. JAM-B/CD322 Protein, Rat (HEK293, His) is the recombinant rat-derived JAM-B/CD322 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

JAM-B/CD322 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/jam-b-cd322-protein-rat-hek293-his.html

Purity

95.90

Smiles

FSASKDHRQEVSVIEYQEAILACKTPKKTTSSRLEWKKLGQGVSLVYYQQALQGDFKDRAEMIDFNIRIKNVTRHDAGEYRCEVSAPTEQGQNLQEDTVMLEVLVAPAVPSCEVPTSVMSGSVVELRCQEKEGNPAPEYIWFKDGTSLLGNPKGGAHRNSSYTMNTKSGTLQFNMISKMDSGEYYCEARNSVGHRRCPGKRMQVDVLN

Molecular Formula

619374 (Gene_ID) Q3MHC0 (F29-N236) (Accession)

Molecular Weight

Approximately 30-35 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GNRH1 Protein Vector (Human) (pPM-C-His)
PV052684 500 ng

GNRH1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Recombinant Human VOPP1 Protein, His, E.coli-1mg
QP13939-1mg 1mg

Recombinant Human VOPP1 Protein, His, E.coli-1mg

Sign In for Pricing
View Details
Caprine Thymus Primary Fibroblasts
CCEL136 5x 10^5 Cells/Vial

Caprine Thymus Primary Fibroblasts

Sign In for Pricing
View Details
SNAPC3 Protein Vector (Human) (pPM-C-HA)
PV058155 500 ng

SNAPC3 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
NUDT21 Mouse Monoclonal Antibody [Clone ID: LBI1B1]
AMM17474VCF 100 µg

NUDT21 Mouse Monoclonal Antibody [Clone ID: LBI1B1]

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) BGAL11 Polyclonal Antibody
MBS9008790 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) BGAL11 Polyclonal Antibody

Sign In for Pricing
View Details