Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JAM-B/CD322, Rat (HEK293, His)

Junctional adhesion molecule 2 (Jam2, Jam-B, CD322) is a member of the immunoglobulin superfamily, and the junctional adhesion molecule (JAM) family. Jam2 is a type I membrane protein that is localized at the tight junctions of both epithelial and endothelial cells. Jam2 has integrin alpha-4/beta-1 binding activity and an inhibitory somatodendritic cue. JAM-B/CD322 Protein, Rat (HEK293, His) is the recombinant rat-derived JAM-B/CD322 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

JAM-B/CD322 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/jam-b-cd322-protein-rat-hek293-his.html

Purity

95.90

Smiles

FSASKDHRQEVSVIEYQEAILACKTPKKTTSSRLEWKKLGQGVSLVYYQQALQGDFKDRAEMIDFNIRIKNVTRHDAGEYRCEVSAPTEQGQNLQEDTVMLEVLVAPAVPSCEVPTSVMSGSVVELRCQEKEGNPAPEYIWFKDGTSLLGNPKGGAHRNSSYTMNTKSGTLQFNMISKMDSGEYYCEARNSVGHRRCPGKRMQVDVLN

Molecular Formula

619374 (Gene_ID) Q3MHC0 (F29-N236) (Accession)

Molecular Weight

Approximately 30-35 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse KERA shRNA Plasmid
abx971173-01 150 µg

Mouse KERA shRNA Plasmid

Sign In for Pricing
View Details
Mouse KERA shRNA Plasmid
abx971173-02 300 µg

Mouse KERA shRNA Plasmid

Sign In for Pricing
View Details
Hsp20 (HSPB6) (NM_144617) Human Tagged Lenti ORF Clone
RC209637L1 10 µg

Hsp20 (HSPB6) (NM_144617) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
PWP1 sgRNA CRISPR Lentivector (Human) (Target 1)
K1762602 1.0 µg DNA

PWP1 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Rabbit Polyclonal ABCG5 Antibody [HRP]
NBP3-06128H 0.1 mL

Rabbit Polyclonal ABCG5 Antibody [HRP]

Sign In for Pricing
View Details
Mouse Ky activation kit by CRISPRa
GA202394 1 Kit

Mouse Ky activation kit by CRISPRa

Sign In for Pricing
View Details