Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JAM-B/CD322, Rat (HEK293, His)

Junctional adhesion molecule 2 (Jam2, Jam-B, CD322) is a member of the immunoglobulin superfamily, and the junctional adhesion molecule (JAM) family. Jam2 is a type I membrane protein that is localized at the tight junctions of both epithelial and endothelial cells. Jam2 has integrin alpha-4/beta-1 binding activity and an inhibitory somatodendritic cue. JAM-B/CD322 Protein, Rat (HEK293, His) is the recombinant rat-derived JAM-B/CD322 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

JAM-B/CD322 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/jam-b-cd322-protein-rat-hek293-his.html

Purity

95.90

Smiles

FSASKDHRQEVSVIEYQEAILACKTPKKTTSSRLEWKKLGQGVSLVYYQQALQGDFKDRAEMIDFNIRIKNVTRHDAGEYRCEVSAPTEQGQNLQEDTVMLEVLVAPAVPSCEVPTSVMSGSVVELRCQEKEGNPAPEYIWFKDGTSLLGNPKGGAHRNSSYTMNTKSGTLQFNMISKMDSGEYYCEARNSVGHRRCPGKRMQVDVLN

Molecular Formula

619374 (Gene_ID) Q3MHC0 (F29-N236) (Accession)

Molecular Weight

Approximately 30-35 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC100359727 3'UTR GFP Stable Cell Line
TU257293 1.0 mL

LOC100359727 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Rabbit DEP Domain-Containing Protein 7 (DEPDC7) ELISA Kit
MBS9915786 Inquire

Rabbit DEP Domain-Containing Protein 7 (DEPDC7) ELISA Kit

Sign In for Pricing
View Details
FJX1 Protein Vector (Human) (pPB-C-His)
PV078493 500 ng

FJX1 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Human REG1b (Regenerating Islet Derived Protein 1 Beta) ELISA Kit
EH24334 96 Tests

Human REG1b (Regenerating Islet Derived Protein 1 Beta) ELISA Kit

Sign In for Pricing
View Details
H Cadherin Polyclonal Antibody, PerCP Conjugated
bs-5822R-PerCP 100 µL

H Cadherin Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
COL7A1 Protein Vector (Rat) (pPM-C-His)
PV261109 500 ng

COL7A1 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details