Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JAM-B/CD322, Rat (HEK293, His)

Junctional adhesion molecule 2 (Jam2, Jam-B, CD322) is a member of the immunoglobulin superfamily, and the junctional adhesion molecule (JAM) family. Jam2 is a type I membrane protein that is localized at the tight junctions of both epithelial and endothelial cells. Jam2 has integrin alpha-4/beta-1 binding activity and an inhibitory somatodendritic cue. JAM-B/CD322 Protein, Rat (HEK293, His) is the recombinant rat-derived JAM-B/CD322 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

JAM-B/CD322 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/jam-b-cd322-protein-rat-hek293-his.html

Purity

95.90

Smiles

FSASKDHRQEVSVIEYQEAILACKTPKKTTSSRLEWKKLGQGVSLVYYQQALQGDFKDRAEMIDFNIRIKNVTRHDAGEYRCEVSAPTEQGQNLQEDTVMLEVLVAPAVPSCEVPTSVMSGSVVELRCQEKEGNPAPEYIWFKDGTSLLGNPKGGAHRNSSYTMNTKSGTLQFNMISKMDSGEYYCEARNSVGHRRCPGKRMQVDVLN

Molecular Formula

619374 (Gene_ID) Q3MHC0 (F29-N236) (Accession)

Molecular Weight

Approximately 30-35 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Pllp (NM_022533) Rat Tagged Lenti ORF Clone
RR209434L3 10 µg

Pllp (NM_022533) Rat Tagged Lenti ORF Clone

Ask
View Details
SRC, phosphorylated (Tyr215) (Proto-oncogene Tyrosine-protein Kinase Src, p60-Src, c-Src, Proto-oncogene c-Src, pp60c-src, SRC1) (APC) discontinued
S6500-10C-APC 200 µL

SRC, phosphorylated (Tyr215) (Proto-oncogene Tyrosine-protein Kinase Src, p60-Src, c-Src, Proto-oncogene c-Src, pp60c-src, SRC1) (APC) discontinued

Ask
View Details
DGKD (NM_152879) Human Tagged Lenti ORF Clone
RC217053L4 10 µg

DGKD (NM_152879) Human Tagged Lenti ORF Clone

Ask
View Details
Human Tubulin Beta-3 Chain (TUBB3) Elisa Kit
EK713996 96 Well

Human Tubulin Beta-3 Chain (TUBB3) Elisa Kit

Ask
View Details