Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JAM-B/CD322, Rat (HEK293, His)

Junctional adhesion molecule 2 (Jam2, Jam-B, CD322) is a member of the immunoglobulin superfamily, and the junctional adhesion molecule (JAM) family. Jam2 is a type I membrane protein that is localized at the tight junctions of both epithelial and endothelial cells. Jam2 has integrin alpha-4/beta-1 binding activity and an inhibitory somatodendritic cue. JAM-B/CD322 Protein, Rat (HEK293, His) is the recombinant rat-derived JAM-B/CD322 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

JAM-B/CD322 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/jam-b-cd322-protein-rat-hek293-his.html

Purity

95.90

Smiles

FSASKDHRQEVSVIEYQEAILACKTPKKTTSSRLEWKKLGQGVSLVYYQQALQGDFKDRAEMIDFNIRIKNVTRHDAGEYRCEVSAPTEQGQNLQEDTVMLEVLVAPAVPSCEVPTSVMSGSVVELRCQEKEGNPAPEYIWFKDGTSLLGNPKGGAHRNSSYTMNTKSGTLQFNMISKMDSGEYYCEARNSVGHRRCPGKRMQVDVLN

Molecular Formula

619374 (Gene_ID) Q3MHC0 (F29-N236) (Accession)

Molecular Weight

Approximately 30-35 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal HNF-4 alpha/NR2A1 Antibody (SR1936)
NBP3-22530-100ul 100 µL

Rabbit Monoclonal HNF-4 alpha/NR2A1 Antibody (SR1936)

Sign In for Pricing
View Details
Recombinant Human Small Ubiquitin-Related Modifier 2, GST
7-06575 5 µg

Recombinant Human Small Ubiquitin-Related Modifier 2, GST

Sign In for Pricing
View Details
Recombinant Clostridium Botulinum selD Protein (aa 1-345)
VAng-Lsx8767-50gEcoli 50 µg (E. coli)

Recombinant Clostridium Botulinum selD Protein (aa 1-345)

Sign In for Pricing
View Details
Mouse Tmem86b Pre-designed siRNA Set B
SI114945B 1 Each

Mouse Tmem86b Pre-designed siRNA Set B

Sign In for Pricing
View Details
Human Monoclonal CD30/TNFRSF8 Antibody (Hu8) [Alexa Fluor 532]
FAB9576X 0.1 mL

Human Monoclonal CD30/TNFRSF8 Antibody (Hu8) [Alexa Fluor 532]

Sign In for Pricing
View Details
MCF2 (NM_005369) Human Tagged ORF Clone
RC218217 10 µg

MCF2 (NM_005369) Human Tagged ORF Clone

Sign In for Pricing
View Details