Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JAM-B/CD322, Rat (HEK293, His)

Junctional adhesion molecule 2 (Jam2, Jam-B, CD322) is a member of the immunoglobulin superfamily, and the junctional adhesion molecule (JAM) family. Jam2 is a type I membrane protein that is localized at the tight junctions of both epithelial and endothelial cells. Jam2 has integrin alpha-4/beta-1 binding activity and an inhibitory somatodendritic cue. JAM-B/CD322 Protein, Rat (HEK293, His) is the recombinant rat-derived JAM-B/CD322 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

JAM-B/CD322 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/jam-b-cd322-protein-rat-hek293-his.html

Purity

95.90

Smiles

FSASKDHRQEVSVIEYQEAILACKTPKKTTSSRLEWKKLGQGVSLVYYQQALQGDFKDRAEMIDFNIRIKNVTRHDAGEYRCEVSAPTEQGQNLQEDTVMLEVLVAPAVPSCEVPTSVMSGSVVELRCQEKEGNPAPEYIWFKDGTSLLGNPKGGAHRNSSYTMNTKSGTLQFNMISKMDSGEYYCEARNSVGHRRCPGKRMQVDVLN

Molecular Formula

619374 (Gene_ID) Q3MHC0 (F29-N236) (Accession)

Molecular Weight

Approximately 30-35 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNAJA1 Rabbit pAb
E45R18519N-100 100 µL

DNAJA1 Rabbit pAb

Sign In for Pricing
View Details
Rat Period Circadian Protein 2 (PER2) CLIA Kit
abx496013-01 96 Tests

Rat Period Circadian Protein 2 (PER2) CLIA Kit

Sign In for Pricing
View Details
Rat Period Circadian Protein 2 (PER2) CLIA Kit
abx496013-02 5x 96 Tests

Rat Period Circadian Protein 2 (PER2) CLIA Kit

Sign In for Pricing
View Details
Rat Period Circadian Protein 2 (PER2) CLIA Kit
abx496013-03 10x 96 Tests

Rat Period Circadian Protein 2 (PER2) CLIA Kit

Sign In for Pricing
View Details
Human Monoclonal CD20 Antibody (Hu11A) [Janelia Fluor 635]
FAB10440JF635 0.1 mL

Human Monoclonal CD20 Antibody (Hu11A) [Janelia Fluor 635]

Sign In for Pricing
View Details
DHRS11 rabbit pAb
ES7568-01 50 µL

DHRS11 rabbit pAb

Sign In for Pricing
View Details