Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Gastric inhibitory polypeptide receptor (GIPR), partial

Product Specifications

Product Name Alternative

Glucose-dependent insulinotropic polypeptide receptor (GIP-R)

Abbreviation

Recombinant Human GIPR protein, partial

Gene Name

GIPR

UniProt

P48546

Expression Region

22-138aa

Organism

Homo sapiens (Human)

Target Sequence

RAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNGSFDMYVCWDYAAPNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQ

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

Baculovirus

Field of Research

Others

Relevance

This is a receptor for GIP. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.3 kDa

References & Citations

"Molecular cloning, functional expression, and signal transduction of the GIP-receptor cloned from a human insulinoma." Volz A., Goke R., Lankat-Buttgereit B., Fehmann H.C., Bode H.P., Goke B. FEBS Lett. 373:23-29 (1995)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD10 (CB-CALLA), CF488A conjugate, 0.1mg/mL
BNC880146-500 1x 500 µL

CD10 (CB-CALLA), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF740 conjugate, 0.1mg/mL
BNC740978-100 1x 100 µL

CD7 (T3-3A1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EGFRvIII (Epidermal Growth Factor Receptor, Variant III) (GFR/2600R), CF594 conjugate, 0.1mg/mL
BNC942600-500 1x 500 µL

EGFRvIII (Epidermal Growth Factor Receptor, Variant III) (GFR/2600R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, Basic (Type II or HMW) (rKRTH/2148), CF740 conjugate, 0.1mg/mL
BNC742148-100 1x 100 µL

Cytokeratin, Basic (Type II or HMW) (rKRTH/2148), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZAP70 (ZAP70/528 + 2F3.2), CF488A conjugate, 0.1mg/mL
BNC881137-500 1x 500 µL

ZAP70 (ZAP70/528 + 2F3.2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (CIP1/823 + DCS-60.2), CF647 conjugate, 0.1mg/mL
BNC471135-500 1x 500 µL

P21 / WAF1 (CIP1/823 + DCS-60.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details