Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UNC5B, Rat (HEK293, Fc)

UNC5B is a netrin-1-dependent receptor. It negatively regulates vascular branching during angiogenesis. In addition, UNC5B protects myelin and partially alleviates injury-induced neuropathic pain (NP) . UNC5B is involved in the guidance of axons and the positive regulation of exogenous apoptosis signaling pathways without binding to netrin-1. UNC5B Protein, Rat (HEK293, Fc) is the recombinant rat-derived UNC5B protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

UNC5B Protein, Rat (HEK293, Fc), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/unc5b-protein-rat-hek293-fc.html

Purity

98.0

Smiles

GIDSGGQALPDSFPSAPAEQLPHFLLEPEDAYIVKNKPVELHCRAFPATQIYFKCNGEWVSQKGHVTQESLDEATGLRIREVQIEVSRQQVEELFGLEDYWCQCVAWSSSGTTKSRRAYIRIAYLRKNFDQEPLAKEVPLDHEVLLQCRPPEGVPVAEVEWLKNEDVIDPAQDTNFLLTIDHNLIIRQARLSDTANYTCVAKNIVAKRRSTTATVIVYVNGGWSSWAEWSPCSNRCGRGWQKRTRTCTNPAPLNGGAFCEGQACQKTACTTVCPVDGAWTEWSKWSACSTECAHWRSRECMAPPPQNGGRDCSGTLLDSKNCTDGLCVLNQRTLNDPKSRPLEPSGD

Molecular Formula

60630 (Gene_ID) O08722/NP_071543.1 (G27-D373) (Accession)

Molecular Weight

Approximately 90 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2- (Bromomethyl) -1,3-diethylbenzene
XZB02213 0.1 g

2- (Bromomethyl) -1,3-diethylbenzene

Sign In for Pricing
View Details
Mouse Monoclonal Dystrophin Antibody (DMD/3242) [FITC]
NBP2-79917F 0.1 mL

Mouse Monoclonal Dystrophin Antibody (DMD/3242) [FITC]

Sign In for Pricing
View Details
Goat Elastin (Elastin) ELISA Kit
YP-W75560-01 48 Tests

Goat Elastin (Elastin) ELISA Kit

Sign In for Pricing
View Details
Goat Elastin (Elastin) ELISA Kit
YP-W75560-02 96 Tests

Goat Elastin (Elastin) ELISA Kit

Sign In for Pricing
View Details
PRS55 rabbit pAb
UB-GEN-7744 100 µL

PRS55 rabbit pAb

Sign In for Pricing
View Details
RPL7AP9 ORF Vector (Human) (pORF)
ORF031019 1.0 µg DNA

RPL7AP9 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details