Apolipoprotein B-100/APOB, Human (His)
Product Specifications
UNSPSC Description
Apolipoprotein B-100 (APOB) is a key component of chylomicrons, LDL and VLDL. It acts as a recognition signal to promote cellular binding and internalization of LDL through apoB/E receptors. Apolipoprotein B-100/APOB Protein, Human (His) is the recombinant human-derived Apolipoprotein B-100/APOB protein, expressed by E. coli , with N-6*His labeled tag. The total length of Apolipoprotein B-100/APOB Protein, Human (His) is 100 a.a., with molecular weight of ~16.0 kDa.
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/apolipoprotein-b-100-apob-protein-human-his.html
Smiles
HHHHHHEEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMS
Molecular Weight
Approximately 16.0 kDa
Shipping Conditions
Blue Ice
Storage Conditions
Stored at -80°C for 1 year
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470257-100 1x 100 µL
Cytokeratin, HMW (AE-3), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880050-100 1x 100 µL
IgA Secretory Component (SC05), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040745-100 1x 100 µL
CD45 / LCA (2B11 + PD7/26), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680226-500 1x 500 µL
Pmel17 / gp100 / SILV (NKI-beteb), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details