Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DKK-1, Human (HEK293)

DKK-1 Proteinas are potent antagonists of canonical Wnt signaling, inhibiting LRP5/6-Wnt interactions and forming a ternary complex with KREMEN to promote LRP5/6 internalization.In addition to its proapoptotic function by antagonizing KREMEN1 independently of Wnt, DKK-1 also exhibits antiapoptotic activity. DKK-1 Protein, Human (HEK293) is the recombinant human-derived DKK-1 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

DKK-1 Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dkk-1-protein-human-235a-a-hek293-tag-free.html

Purity

97.00

Smiles

TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH

Molecular Formula

22943 (Gene_ID) O94907 (T32-H266) (Accession)

Molecular Weight

Approximately 38-48 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DEFB129 Polyclonal Antibody
MBS9235062-01 0.1 mL

DEFB129 Polyclonal Antibody

Sign In for Pricing
View Details
DEFB129 Polyclonal Antibody
MBS9235062-02 5x 0.1 mL

DEFB129 Polyclonal Antibody

Sign In for Pricing
View Details
TBB
GK1120-25mg 25 mg

TBB

Sign In for Pricing
View Details
Rpl11 (NM_025919) Mouse Tagged ORF Clone Lentiviral Particle
MR201576L3V 200 µL

Rpl11 (NM_025919) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Brain Section Mold (sagittal section, suitable for rat brain, slice thickness of 0.5mm)
SQP-Z15 1 Each

Brain Section Mold (sagittal section, suitable for rat brain, slice thickness of 0.5mm)

Sign In for Pricing
View Details
Methyl 1,1,2,2-tetrafluoroethyl ether
sc-263475A 250 g

Methyl 1,1,2,2-tetrafluoroethyl ether

Sign In for Pricing
View Details