Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DKK-1, Human (HEK293)

DKK-1 Proteinas are potent antagonists of canonical Wnt signaling, inhibiting LRP5/6-Wnt interactions and forming a ternary complex with KREMEN to promote LRP5/6 internalization.In addition to its proapoptotic function by antagonizing KREMEN1 independently of Wnt, DKK-1 also exhibits antiapoptotic activity. DKK-1 Protein, Human (HEK293) is the recombinant human-derived DKK-1 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

DKK-1 Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dkk-1-protein-human-235a-a-hek293-tag-free.html

Purity

97.00

Smiles

TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH

Molecular Formula

22943 (Gene_ID) O94907 (T32-H266) (Accession)

Molecular Weight

Approximately 38-48 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IRGM Protein Vector (Rat) (pPB-N-His)
PV275015 500 ng

IRGM Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Histone H3R26me2a Antibody
MBS9407030-01 0.05 mL

Histone H3R26me2a Antibody

Sign In for Pricing
View Details
Histone H3R26me2a Antibody
MBS9407030-02 0.1 mL

Histone H3R26me2a Antibody

Sign In for Pricing
View Details
Histone H3R26me2a Antibody
MBS9407030-03 5x 0.1 mL

Histone H3R26me2a Antibody

Sign In for Pricing
View Details
Stmn4 sgRNA CRISPR Lentivector (Rat) (Target 2)
K7123303 1.0 µg DNA

Stmn4 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
CKS1 antibody
70R-31788 100 ug

CKS1 antibody

Sign In for Pricing
View Details