Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DKK-1, Human (HEK293)

DKK-1 Proteinas are potent antagonists of canonical Wnt signaling, inhibiting LRP5/6-Wnt interactions and forming a ternary complex with KREMEN to promote LRP5/6 internalization.In addition to its proapoptotic function by antagonizing KREMEN1 independently of Wnt, DKK-1 also exhibits antiapoptotic activity. DKK-1 Protein, Human (HEK293) is the recombinant human-derived DKK-1 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

DKK-1 Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dkk-1-protein-human-235a-a-hek293-tag-free.html

Purity

97.00

Smiles

TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH

Molecular Formula

22943 (Gene_ID) O94907 (T32-H266) (Accession)

Molecular Weight

Approximately 38-48 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human CD32/FCGR2A Antibody (SAA1415), PE
MBS1583182-01 50 Tests

Anti-Human CD32/FCGR2A Antibody (SAA1415), PE

Sign In for Pricing
View Details
Anti-Human CD32/FCGR2A Antibody (SAA1415), PE
MBS1583182-02 100 Tests

Anti-Human CD32/FCGR2A Antibody (SAA1415), PE

Sign In for Pricing
View Details
Anti-Human CD32/FCGR2A Antibody (SAA1415), PE
MBS1583182-03 5x 100 Tests

Anti-Human CD32/FCGR2A Antibody (SAA1415), PE

Sign In for Pricing
View Details
Zfp422 Recombinant Protein (Mouse)
RP187097 100 µg

Zfp422 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
CISD2 Antibody, HRP conjugated
A63364-50UG 50 µg

CISD2 Antibody, HRP conjugated

Sign In for Pricing
View Details
ABCB4 Rabbit Polyclonal Antibody
TA346193 100 µL

ABCB4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details