Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DKK-1, Human (HEK293)

DKK-1 Proteinas are potent antagonists of canonical Wnt signaling, inhibiting LRP5/6-Wnt interactions and forming a ternary complex with KREMEN to promote LRP5/6 internalization.In addition to its proapoptotic function by antagonizing KREMEN1 independently of Wnt, DKK-1 also exhibits antiapoptotic activity. DKK-1 Protein, Human (HEK293) is the recombinant human-derived DKK-1 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

DKK-1 Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dkk-1-protein-human-235a-a-hek293-tag-free.html

Purity

97.00

Smiles

TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH

Molecular Formula

22943 (Gene_ID) O94907 (T32-H266) (Accession)

Molecular Weight

Approximately 38-48 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMP10 Recombinant Rabbit mAb, detector
E47P0088D 100 µL

MMP10 Recombinant Rabbit mAb, detector

Sign In for Pricing
View Details
Human beta-Catenin MAb (Clone 196618)
MAB13291-100 100 µg

Human beta-Catenin MAb (Clone 196618)

Sign In for Pricing
View Details
CYP2T2P 3'UTR GFP Stable Cell Line
TU055469 1.0 mL

CYP2T2P 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
hsa-miR-6765-3p miRNA Inhibitor
MBS8294994-01 10 nmol

hsa-miR-6765-3p miRNA Inhibitor

Sign In for Pricing
View Details
hsa-miR-6765-3p miRNA Inhibitor
MBS8294994-02 20 nmol

hsa-miR-6765-3p miRNA Inhibitor

Sign In for Pricing
View Details
hsa-miR-6765-3p miRNA Inhibitor
MBS8294994-03 5x 20 nmol

hsa-miR-6765-3p miRNA Inhibitor

Sign In for Pricing
View Details