Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DKK-1, Human (HEK293)

DKK-1 Proteinas are potent antagonists of canonical Wnt signaling, inhibiting LRP5/6-Wnt interactions and forming a ternary complex with KREMEN to promote LRP5/6 internalization.In addition to its proapoptotic function by antagonizing KREMEN1 independently of Wnt, DKK-1 also exhibits antiapoptotic activity. DKK-1 Protein, Human (HEK293) is the recombinant human-derived DKK-1 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

DKK-1 Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dkk-1-protein-human-235a-a-hek293-tag-free.html

Purity

97.00

Smiles

TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH

Molecular Formula

22943 (Gene_ID) O94907 (T32-H266) (Accession)

Molecular Weight

Approximately 38-48 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calcyphosine (CAPS) Antibody
abx171521 1 mL

Calcyphosine (CAPS) Antibody

Sign In for Pricing
View Details
RET ligand-3
HY-170853 1 Each

RET ligand-3

Sign In for Pricing
View Details
Recombinant Human USP32 Protein
E30P9425 20 µg

Recombinant Human USP32 Protein

Sign In for Pricing
View Details
THEM4 3'UTR GFP Stable Cell Line
TU075532 1.0 mL

THEM4 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Mouse Monoclonal DOK7 Antibody (OTI1A9) [Alexa Fluor 488]
NBP2-72494AF488 0.1 mL

Mouse Monoclonal DOK7 Antibody (OTI1A9) [Alexa Fluor 488]

Sign In for Pricing
View Details
Anti-STOML2 antibody
STJ112434 100 µl

Anti-STOML2 antibody

Sign In for Pricing
View Details