Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DKK-1, Human (HEK293)

DKK-1 Proteinas are potent antagonists of canonical Wnt signaling, inhibiting LRP5/6-Wnt interactions and forming a ternary complex with KREMEN to promote LRP5/6 internalization.In addition to its proapoptotic function by antagonizing KREMEN1 independently of Wnt, DKK-1 also exhibits antiapoptotic activity. DKK-1 Protein, Human (HEK293) is the recombinant human-derived DKK-1 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

DKK-1 Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dkk-1-protein-human-235a-a-hek293-tag-free.html

Purity

97.00

Smiles

TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH

Molecular Formula

22943 (Gene_ID) O94907 (T32-H266) (Accession)

Molecular Weight

Approximately 38-48 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit proBNP ELISA Kit
ERTB0210 96 Tests

Rabbit proBNP ELISA Kit

Sign In for Pricing
View Details
GTP-binding protein 1 (GTPBP1) Human ELISA Kit
D8848 96 Tests

GTP-binding protein 1 (GTPBP1) Human ELISA Kit

Sign In for Pricing
View Details
PTK9 (TWF1) (NM_002822) Human Tagged Lenti ORF Clone
RC207215L3 10 µg

PTK9 (TWF1) (NM_002822) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Zidesamtinib
MBS5815193 Inquire

Zidesamtinib

Sign In for Pricing
View Details
Anti-Src Rabbit Monoclonal Antibody
MBS179111-01 0.03 mL

Anti-Src Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Src Rabbit Monoclonal Antibody
MBS179111-02 0.1 mL

Anti-Src Rabbit Monoclonal Antibody

Sign In for Pricing
View Details