Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DKK-1, Human (HEK293)

DKK-1 Proteinas are potent antagonists of canonical Wnt signaling, inhibiting LRP5/6-Wnt interactions and forming a ternary complex with KREMEN to promote LRP5/6 internalization.In addition to its proapoptotic function by antagonizing KREMEN1 independently of Wnt, DKK-1 also exhibits antiapoptotic activity. DKK-1 Protein, Human (HEK293) is the recombinant human-derived DKK-1 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

DKK-1 Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dkk-1-protein-human-235a-a-hek293-tag-free.html

Purity

97.00

Smiles

TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH

Molecular Formula

22943 (Gene_ID) O94907 (T32-H266) (Accession)

Molecular Weight

Approximately 38-48 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTTY5 CRISPRa sgRNA lentivector (set of three targets)(Human)
48778121 3x 1.0µg DNA

TTTY5 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
ACOX3 Antibody
A72897-100UL 100 µL

ACOX3 Antibody

Sign In for Pricing
View Details
RPS26P36 Adenovirus (Human)
42323051 1.0 mL

RPS26P36 Adenovirus (Human)

Sign In for Pricing
View Details
HTATSF1 Antibody
F40058-0.08ML 0.08 mL

HTATSF1 Antibody

Sign In for Pricing
View Details
Sodium-dependent phosphate transport protein 2B (SLC34A2) Human ELISA Kit
H1600 96 Tests

Sodium-dependent phosphate transport protein 2B (SLC34A2) Human ELISA Kit

Sign In for Pricing
View Details
Recombinant Pongo pygmaeus Beta-nerve growth factor (NGF)
MBS1305024-01 0.02 mg (E-Coli)

Recombinant Pongo pygmaeus Beta-nerve growth factor (NGF)

Sign In for Pricing
View Details