Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DKK-1, Human (HEK293)

DKK-1 Proteinas are potent antagonists of canonical Wnt signaling, inhibiting LRP5/6-Wnt interactions and forming a ternary complex with KREMEN to promote LRP5/6 internalization.In addition to its proapoptotic function by antagonizing KREMEN1 independently of Wnt, DKK-1 also exhibits antiapoptotic activity. DKK-1 Protein, Human (HEK293) is the recombinant human-derived DKK-1 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

DKK-1 Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dkk-1-protein-human-235a-a-hek293-tag-free.html

Purity

97.00

Smiles

TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH

Molecular Formula

22943 (Gene_ID) O94907 (T32-H266) (Accession)

Molecular Weight

Approximately 38-48 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Corynebacterium Diphtheriae nucS Protein (aa 1-229)
VAng-Lsx2770-1mgEcoli 1 mg (E. coli)

Recombinant Corynebacterium Diphtheriae nucS Protein (aa 1-229)

Sign In for Pricing
View Details
Rabbit Adipocyte Enhancer-Binding Protein 1 (AEBP1) ELISA Kit
MBS9903969 Inquire

Rabbit Adipocyte Enhancer-Binding Protein 1 (AEBP1) ELISA Kit

Sign In for Pricing
View Details
Recombinant Rat Taste receptor type 2 member 41 (Tas2r41), partial
MBS7101339 Inquire

Recombinant Rat Taste receptor type 2 member 41 (Tas2r41), partial

Sign In for Pricing
View Details
RPS27AP9 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV784653 1.0 µg DNA

RPS27AP9 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Human CREBBP Knockout HEK293T cell line
GTR15417768 1 Vial

Human CREBBP Knockout HEK293T cell line

Sign In for Pricing
View Details
RPL38 Recombinant Protein (Human)
RP092433 100 µg

RPL38 Recombinant Protein (Human)

Sign In for Pricing
View Details