Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DKK-1, Human (HEK293)

DKK-1 Proteinas are potent antagonists of canonical Wnt signaling, inhibiting LRP5/6-Wnt interactions and forming a ternary complex with KREMEN to promote LRP5/6 internalization.In addition to its proapoptotic function by antagonizing KREMEN1 independently of Wnt, DKK-1 also exhibits antiapoptotic activity. DKK-1 Protein, Human (HEK293) is the recombinant human-derived DKK-1 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

DKK-1 Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dkk-1-protein-human-235a-a-hek293-tag-free.html

Purity

97.00

Smiles

TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH

Molecular Formula

22943 (Gene_ID) O94907 (T32-H266) (Accession)

Molecular Weight

Approximately 38-48 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ROR2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3H3]
TA810008BM 100 µL

ROR2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3H3]

Sign In for Pricing
View Details
Recombinant Rhodococcus erythropolis UPF0060 membrane protein RER_49640 (RER_49640)
MBS7039604-01 0.02 mg

Recombinant Rhodococcus erythropolis UPF0060 membrane protein RER_49640 (RER_49640)

Sign In for Pricing
View Details
Recombinant Rhodococcus erythropolis UPF0060 membrane protein RER_49640 (RER_49640)
MBS7039604-02 0.1 mg

Recombinant Rhodococcus erythropolis UPF0060 membrane protein RER_49640 (RER_49640)

Sign In for Pricing
View Details
Recombinant Rhodococcus erythropolis UPF0060 membrane protein RER_49640 (RER_49640)
MBS7039604-03 5x 0.1 mg

Recombinant Rhodococcus erythropolis UPF0060 membrane protein RER_49640 (RER_49640)

Sign In for Pricing
View Details
ZRANB3 (NM_032143) Human Tagged Lenti ORF Clone
RC222784L3 10 µg

ZRANB3 (NM_032143) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mycbpap (NM_001009482) Rat Untagged Clone
RN205515 10 µg

Mycbpap (NM_001009482) Rat Untagged Clone

Sign In for Pricing
View Details