Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DKK-1, Human (HEK293)

DKK-1 Proteinas are potent antagonists of canonical Wnt signaling, inhibiting LRP5/6-Wnt interactions and forming a ternary complex with KREMEN to promote LRP5/6 internalization.In addition to its proapoptotic function by antagonizing KREMEN1 independently of Wnt, DKK-1 also exhibits antiapoptotic activity. DKK-1 Protein, Human (HEK293) is the recombinant human-derived DKK-1 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

DKK-1 Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dkk-1-protein-human-235a-a-hek293-tag-free.html

Purity

97.00

Smiles

TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH

Molecular Formula

22943 (Gene_ID) O94907 (T32-H266) (Accession)

Molecular Weight

Approximately 38-48 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pla1a (NM_138882) Rat Tagged ORF Clone Lentiviral Particle
RR208668L4V 200 µL

Pla1a (NM_138882) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Influenza A virus (H1N1) HA/Hemagglutinin Protein, C-His
E55P4127 50 µg

Recombinant Influenza A virus (H1N1) HA/Hemagglutinin Protein, C-His

Sign In for Pricing
View Details
Research Grade Posdinemab
HY086066-01 100 µg

Research Grade Posdinemab

Sign In for Pricing
View Details
Research Grade Posdinemab
HY086066-02 1 mg

Research Grade Posdinemab

Sign In for Pricing
View Details
Rabbit Polyclonal Cbl-c Antibody [FITC]
NBP2-97089F 0.1 mL

Rabbit Polyclonal Cbl-c Antibody [FITC]

Sign In for Pricing
View Details
Mouse Protein Tyrosine Phosphatase, Non Receptor Type 12 (PTPN12) ELISA Kit
MBS2162143-01 24 Strip Well

Mouse Protein Tyrosine Phosphatase, Non Receptor Type 12 (PTPN12) ELISA Kit

Sign In for Pricing
View Details