Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DKK-1, Human (HEK293)

DKK-1 Proteinas are potent antagonists of canonical Wnt signaling, inhibiting LRP5/6-Wnt interactions and forming a ternary complex with KREMEN to promote LRP5/6 internalization.In addition to its proapoptotic function by antagonizing KREMEN1 independently of Wnt, DKK-1 also exhibits antiapoptotic activity. DKK-1 Protein, Human (HEK293) is the recombinant human-derived DKK-1 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

DKK-1 Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dkk-1-protein-human-235a-a-hek293-tag-free.html

Purity

97.00

Smiles

TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH

Molecular Formula

22943 (Gene_ID) O94907 (T32-H266) (Accession)

Molecular Weight

Approximately 38-48 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SPRYD5 Antibody
NBP3-05825-50ul 50 µL

Rabbit Polyclonal SPRYD5 Antibody

Sign In for Pricing
View Details
SPN/CD43, NT (SPN, CD43, Leukosialin, Galactoglycoprotein, Leukocyte sialoglycoprotein, Sialophorin, CD_antigen=CD43) (AP) discontinued
031262-AP 100 µL

SPN/CD43, NT (SPN, CD43, Leukosialin, Galactoglycoprotein, Leukocyte sialoglycoprotein, Sialophorin, CD_antigen=CD43) (AP) discontinued

Sign In for Pricing
View Details
RalBP1 polyclonal antibody
CAS7517-01 50 µL

RalBP1 polyclonal antibody

Sign In for Pricing
View Details
RalBP1 polyclonal antibody
CAS7517-02 100 µL

RalBP1 polyclonal antibody

Sign In for Pricing
View Details
Magic™ Membrane Protein Human ITGAL (Integrin subunit alpha L) Full Length
MPC3441K Each

Magic™ Membrane Protein Human ITGAL (Integrin subunit alpha L) Full Length

Sign In for Pricing
View Details
Human GPR172B (SLC52A1) activation kit by CRISPRa
GA110488 1 Kit

Human GPR172B (SLC52A1) activation kit by CRISPRa

Sign In for Pricing
View Details