Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DKK-1, Human (HEK293)

DKK-1 Proteinas are potent antagonists of canonical Wnt signaling, inhibiting LRP5/6-Wnt interactions and forming a ternary complex with KREMEN to promote LRP5/6 internalization.In addition to its proapoptotic function by antagonizing KREMEN1 independently of Wnt, DKK-1 also exhibits antiapoptotic activity. DKK-1 Protein, Human (HEK293) is the recombinant human-derived DKK-1 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

DKK-1 Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dkk-1-protein-human-235a-a-hek293-tag-free.html

Purity

97.00

Smiles

TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH

Molecular Formula

22943 (Gene_ID) O94907 (T32-H266) (Accession)

Molecular Weight

Approximately 38-48 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Epidermal growth factor,EGF ELISA KIT
JOT-EK0152Ra 96 wells

Rat Epidermal growth factor,EGF ELISA KIT

Sign In for Pricing
View Details
GENLISA™ Human Homing Associated Cell Adhesion Molecule (HCAM) ELISA
KBH21122 1x 96 Well

GENLISA™ Human Homing Associated Cell Adhesion Molecule (HCAM) ELISA

Sign In for Pricing
View Details
Mouse Fermt2 ELISA Kit
EF014903 96 Tests

Mouse Fermt2 ELISA Kit

Sign In for Pricing
View Details
MCP-1-Rat LumiAb ELISA Kit
Lum-8210 1 Kit

MCP-1-Rat LumiAb ELISA Kit

Sign In for Pricing
View Details
ZDHHC4P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV790098 1.0 µg DNA

ZDHHC4P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
SNX33 AAV siRNA Pooled Vector
45079161 1.0 µg

SNX33 AAV siRNA Pooled Vector

Sign In for Pricing
View Details