Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DKK-1, Human (HEK293)

DKK-1 Proteinas are potent antagonists of canonical Wnt signaling, inhibiting LRP5/6-Wnt interactions and forming a ternary complex with KREMEN to promote LRP5/6 internalization.In addition to its proapoptotic function by antagonizing KREMEN1 independently of Wnt, DKK-1 also exhibits antiapoptotic activity. DKK-1 Protein, Human (HEK293) is the recombinant human-derived DKK-1 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

DKK-1 Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dkk-1-protein-human-235a-a-hek293-tag-free.html

Purity

97.00

Smiles

TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH

Molecular Formula

22943 (Gene_ID) O94907 (T32-H266) (Accession)

Molecular Weight

Approximately 38-48 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DHHC-7 Antibody
C17599-01 50 μL

DHHC-7 Antibody

Sign In for Pricing
View Details
DHHC-7 Antibody
C17599-02 100 µL

DHHC-7 Antibody

Sign In for Pricing
View Details
Monkey Anti-Bullous Pemphigoid 180 Antibody (anti-BP180-Ab) ELISA Kit
MBS7262410-01 48 Well

Monkey Anti-Bullous Pemphigoid 180 Antibody (anti-BP180-Ab) ELISA Kit

Sign In for Pricing
View Details
Monkey Anti-Bullous Pemphigoid 180 Antibody (anti-BP180-Ab) ELISA Kit
MBS7262410-02 96 Well

Monkey Anti-Bullous Pemphigoid 180 Antibody (anti-BP180-Ab) ELISA Kit

Sign In for Pricing
View Details
Monkey Anti-Bullous Pemphigoid 180 Antibody (anti-BP180-Ab) ELISA Kit
MBS7262410-03 5x 96 Well

Monkey Anti-Bullous Pemphigoid 180 Antibody (anti-BP180-Ab) ELISA Kit

Sign In for Pricing
View Details
Monkey Anti-Bullous Pemphigoid 180 Antibody (anti-BP180-Ab) ELISA Kit
MBS7262410-04 10x 96 Well

Monkey Anti-Bullous Pemphigoid 180 Antibody (anti-BP180-Ab) ELISA Kit

Sign In for Pricing
View Details