Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DKK-1, Human (HEK293)

DKK-1 Proteinas are potent antagonists of canonical Wnt signaling, inhibiting LRP5/6-Wnt interactions and forming a ternary complex with KREMEN to promote LRP5/6 internalization.In addition to its proapoptotic function by antagonizing KREMEN1 independently of Wnt, DKK-1 also exhibits antiapoptotic activity. DKK-1 Protein, Human (HEK293) is the recombinant human-derived DKK-1 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

DKK-1 Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dkk-1-protein-human-235a-a-hek293-tag-free.html

Purity

97.00

Smiles

TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH

Molecular Formula

22943 (Gene_ID) O94907 (T32-H266) (Accession)

Molecular Weight

Approximately 38-48 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PJVK Rabbit Polyclonal Antibody
JOT-AP11956-01 50ul

PJVK Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PJVK Rabbit Polyclonal Antibody
JOT-AP11956-02 100ul

PJVK Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal DAP Kinase 2 Antibody (OTI1C5) [mFluor Violet 450 SE]
NBP2-71753MFV450 0.1 mL

Mouse Monoclonal DAP Kinase 2 Antibody (OTI1C5) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Human Monoclonal Siglec-15 Antibody (AB-25E9) [Janelia Fluor 635]
NBP3-28008JF635 0.1 mL

Human Monoclonal Siglec-15 Antibody (AB-25E9) [Janelia Fluor 635]

Sign In for Pricing
View Details
Recombinant Human Collagen alpha-2(IV) chain Protein, His, E.coli-100ug
QP8734-ec-100ug 100ug

Recombinant Human Collagen alpha-2(IV) chain Protein, His, E.coli-100ug

Sign In for Pricing
View Details
Lentiviral mouse Slamf1 shRNA (UAS) - Lentiviral mouseSlamf1 shRNA (UAS, GFP) (25)
GTR15140624 1 Vial

Lentiviral mouse Slamf1 shRNA (UAS) - Lentiviral mouseSlamf1 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details