Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DKK-1, Human (HEK293)

DKK-1 Proteinas are potent antagonists of canonical Wnt signaling, inhibiting LRP5/6-Wnt interactions and forming a ternary complex with KREMEN to promote LRP5/6 internalization.In addition to its proapoptotic function by antagonizing KREMEN1 independently of Wnt, DKK-1 also exhibits antiapoptotic activity. DKK-1 Protein, Human (HEK293) is the recombinant human-derived DKK-1 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

DKK-1 Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dkk-1-protein-human-235a-a-hek293-tag-free.html

Purity

97.00

Smiles

TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH

Molecular Formula

22943 (Gene_ID) O94907 (T32-H266) (Accession)

Molecular Weight

Approximately 38-48 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Serine Protease Inhibitor Kazal-Type 2 (SPINK2) ELISA Kit
RD-SPINK2-Hu-01 48 Tests

Human Serine Protease Inhibitor Kazal-Type 2 (SPINK2) ELISA Kit

Sign In for Pricing
View Details
Human Serine Protease Inhibitor Kazal-Type 2 (SPINK2) ELISA Kit
RD-SPINK2-Hu-02 96 Tests

Human Serine Protease Inhibitor Kazal-Type 2 (SPINK2) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human LY6G6D Protein
E30P3351 20 µg

Recombinant Human LY6G6D Protein

Sign In for Pricing
View Details
Taar7e Mouse siRNA Oligo Duplex (Locus ID 276742)
SR412093 1 Kit

Taar7e Mouse siRNA Oligo Duplex (Locus ID 276742)

Sign In for Pricing
View Details
Recombinant Human GRPEL2, His-tagged
GRPEL2-13550H 25 µg

Recombinant Human GRPEL2, His-tagged

Sign In for Pricing
View Details
ANGPT2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV670508 1.0 µg DNA

ANGPT2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details