Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin B, Mouse (HEK293, His)

Cathepsin B Protein, Mouse (HEK293, His) is an approximately 32-50 kDa Cathepsin B protein with a His-flag. Cathepsin B is an enzymatic protein belonging to the peptidase C1 family[1].

Product Specifications

Product Name Alternative

Cathepsin B Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-b-protein-mouse-hek293-his.html

Purity

98.30

Smiles

HDKPSFHPLSDDLINYINKQNTTWQAGRNFYNVDISYLKKLCGTVLGGPKLPGRVAFGEDIDLPETFDAREQWSNCPTIGQIRDQGSCGSCWAFGAVEAISDRTCIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWSFWTKKGLVSGGVYNSHVGCLPYTIPPCEHHVNGSRPPCTGEGDTPRCNKSCEAGYSPSYKEDKHFGYTSYSVSNSVKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDMMGGHAIRILGWGVENGVPYWLAANSWNLDWGDNGFFKILRGENHCGIESEIVAGIPRTDQYWGRFHHHHHH

Molecular Formula

13030 (Gene_ID) P10605 (H18-F339) (Accession)

Molecular Weight

Approximately 32-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Izabela Podgorski, et al. Cathepsin B and its role (s) in cancer progression. Biochem Soc Symp. 2003; (70) :263-76.|[2]W Morikawa, et al. Angiostatin generation by cathepsin D secreted by human prostate carcinoma cells. J Biol Chem. 2000 Dec 8;275 (49) :38912-20.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal IL-3R alpha/CD123 Antibody (7G3) [Janelia Fluor 549] - Chimeric
NBP3-20160JF549 0.1 mL

Rabbit Monoclonal IL-3R alpha/CD123 Antibody (7G3) [Janelia Fluor 549] - Chimeric

Sign In for Pricing
View Details
Herpes Simplex Virus-2 (HSV-2) Glycoprotein D, Glycosylated, Recombinant
GWB-DD4182 1 mg

Herpes Simplex Virus-2 (HSV-2) Glycoprotein D, Glycosylated, Recombinant

Sign In for Pricing
View Details
KRT36, NT (KRT36, HHA6, HKA6, KRTHA6, Keratin, type I cuticular Ha6, Hair keratin, type I Ha6, Keratin-36) (MaxLight 550)
MBS6314696-01 0.1 mL

KRT36, NT (KRT36, HHA6, HKA6, KRTHA6, Keratin, type I cuticular Ha6, Hair keratin, type I Ha6, Keratin-36) (MaxLight 550)

Sign In for Pricing
View Details
KRT36, NT (KRT36, HHA6, HKA6, KRTHA6, Keratin, type I cuticular Ha6, Hair keratin, type I Ha6, Keratin-36) (MaxLight 550)
MBS6314696-02 5x 0.1 mL

KRT36, NT (KRT36, HHA6, HKA6, KRTHA6, Keratin, type I cuticular Ha6, Hair keratin, type I Ha6, Keratin-36) (MaxLight 550)

Sign In for Pricing
View Details
Human Soluble Endoglin (sENG / sCD105) ELISA Kit
MBS269385-01 48 Well

Human Soluble Endoglin (sENG / sCD105) ELISA Kit

Sign In for Pricing
View Details
Human Soluble Endoglin (sENG / sCD105) ELISA Kit
MBS269385-02 96 Well

Human Soluble Endoglin (sENG / sCD105) ELISA Kit

Sign In for Pricing
View Details