Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin B, Mouse (HEK293, His)

Cathepsin B Protein, Mouse (HEK293, His) is an approximately 32-50 kDa Cathepsin B protein with a His-flag. Cathepsin B is an enzymatic protein belonging to the peptidase C1 family[1].

Product Specifications

Product Name Alternative

Cathepsin B Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-b-protein-mouse-hek293-his.html

Purity

98.30

Smiles

HDKPSFHPLSDDLINYINKQNTTWQAGRNFYNVDISYLKKLCGTVLGGPKLPGRVAFGEDIDLPETFDAREQWSNCPTIGQIRDQGSCGSCWAFGAVEAISDRTCIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWSFWTKKGLVSGGVYNSHVGCLPYTIPPCEHHVNGSRPPCTGEGDTPRCNKSCEAGYSPSYKEDKHFGYTSYSVSNSVKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDMMGGHAIRILGWGVENGVPYWLAANSWNLDWGDNGFFKILRGENHCGIESEIVAGIPRTDQYWGRFHHHHHH

Molecular Formula

13030 (Gene_ID) P10605 (H18-F339) (Accession)

Molecular Weight

Approximately 32-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Izabela Podgorski, et al. Cathepsin B and its role (s) in cancer progression. Biochem Soc Symp. 2003; (70) :263-76.|[2]W Morikawa, et al. Angiostatin generation by cathepsin D secreted by human prostate carcinoma cells. J Biol Chem. 2000 Dec 8;275 (49) :38912-20.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS3AP49 sgRNA CRISPR Lentivector (Human) (Target 3)
K2009404 1.0 µg DNA

RPS3AP49 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
1R,3S-RSL 3
MBS3617281-01 5 mg

1R,3S-RSL 3

Sign In for Pricing
View Details
1R,3S-RSL 3
MBS3617281-02 10 mg

1R,3S-RSL 3

Sign In for Pricing
View Details
1R,3S-RSL 3
MBS3617281-03 25 mg

1R,3S-RSL 3

Sign In for Pricing
View Details
1R,3S-RSL 3
MBS3617281-04 50 mg

1R,3S-RSL 3

Sign In for Pricing
View Details
1R,3S-RSL 3
MBS3617281-05 100 mg

1R,3S-RSL 3

Sign In for Pricing
View Details