Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin B, Mouse (HEK293, His)

Cathepsin B Protein, Mouse (HEK293, His) is an approximately 32-50 kDa Cathepsin B protein with a His-flag. Cathepsin B is an enzymatic protein belonging to the peptidase C1 family[1].

Product Specifications

Product Name Alternative

Cathepsin B Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-b-protein-mouse-hek293-his.html

Purity

98.30

Smiles

HDKPSFHPLSDDLINYINKQNTTWQAGRNFYNVDISYLKKLCGTVLGGPKLPGRVAFGEDIDLPETFDAREQWSNCPTIGQIRDQGSCGSCWAFGAVEAISDRTCIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWSFWTKKGLVSGGVYNSHVGCLPYTIPPCEHHVNGSRPPCTGEGDTPRCNKSCEAGYSPSYKEDKHFGYTSYSVSNSVKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDMMGGHAIRILGWGVENGVPYWLAANSWNLDWGDNGFFKILRGENHCGIESEIVAGIPRTDQYWGRFHHHHHH

Molecular Formula

13030 (Gene_ID) P10605 (H18-F339) (Accession)

Molecular Weight

Approximately 32-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Izabela Podgorski, et al. Cathepsin B and its role (s) in cancer progression. Biochem Soc Symp. 2003; (70) :263-76.|[2]W Morikawa, et al. Angiostatin generation by cathepsin D secreted by human prostate carcinoma cells. J Biol Chem. 2000 Dec 8;275 (49) :38912-20.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CTNNBL1 Pre-designed siRNA Set A
SI003771A 1 Each

Human CTNNBL1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
4- ({[ (2,3,5,6-tetramethylphenyl) sulfonyl]amino}methyl) benzoic acid
sc-347507 250 mg

4- ({[ (2,3,5,6-tetramethylphenyl) sulfonyl]amino}methyl) benzoic acid

Sign In for Pricing
View Details
Trir (NM_026760) Mouse Untagged Clone
MC204546 10 µg

Trir (NM_026760) Mouse Untagged Clone

Sign In for Pricing
View Details
Anti-WNT16 Antibody, Rabbit Polyclonal
MBS8102940-01 0.1 mL

Anti-WNT16 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-WNT16 Antibody, Rabbit Polyclonal
MBS8102940-02 5x 0.1 mL

Anti-WNT16 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Hras Mouse qPCR Primer Pair (NM_001130443)
MP220159 200 Reactions

Hras Mouse qPCR Primer Pair (NM_001130443)

Sign In for Pricing
View Details