IGF2, Human
IGF2 Protein, Human is a mitogenic cytokine, binds to IGF type 1 receptor, and modulates growth in many tissues, such as nervous tissue, lymphoid tissue, reproductive tissue, smooth muscle, endothelium, and bone.
Product Specifications
Product Name Alternative
IGF2 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/igf2-protein-human.html
Purity
98.0
Smiles
MAYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE
Molecular Formula
3481 (Gene_ID) P01344-1 (A25-E91) (Accession)
Molecular Weight
Approximately 8-11 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Richman C, et al. Recombinant human insulin-like growth factor-binding protein-5 stimulates bone formation parameters in vitro and in vivo. Endocrinology. 1999 Oct;140 (10) :4699-705.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC402707-100 1x 100 µL
Tal1 (TAL1/2707), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC743022-100 1x 100 µL
MerTK (Innate Immune Checkpoint) (MERTK/3022), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
