Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGF2, Human

IGF2 Protein, Human is a mitogenic cytokine, binds to IGF type 1 receptor, and modulates growth in many tissues, such as nervous tissue, lymphoid tissue, reproductive tissue, smooth muscle, endothelium, and bone.

Product Specifications

Product Name Alternative

IGF2 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igf2-protein-human.html

Purity

98.0

Smiles

MAYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE

Molecular Formula

3481 (Gene_ID) P01344-1 (A25-E91) (Accession)

Molecular Weight

Approximately 8-11 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Richman C, et al. Recombinant human insulin-like growth factor-binding protein-5 stimulates bone formation parameters in vitro and in vivo. Endocrinology. 1999 Oct;140 (10) :4699-705.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AFG3L2 Antibody
A12096-100UL 100 µL

AFG3L2 Antibody

Sign In for Pricing
View Details
Recombinant Human ALK4 / ACVR1B Protein (His tag)
E53A07568 50 µg

Recombinant Human ALK4 / ACVR1B Protein (His tag)

Sign In for Pricing
View Details
Vmp1 Rat shRNA Plasmid (Locus ID 192129)
TR712900 1 Kit

Vmp1 Rat shRNA Plasmid (Locus ID 192129)

Sign In for Pricing
View Details
PSCA His Tag Protein, Mouse
UA011068-01 25 µg

PSCA His Tag Protein, Mouse

Sign In for Pricing
View Details
PSCA His Tag Protein, Mouse
UA011068-02 100 µg

PSCA His Tag Protein, Mouse

Sign In for Pricing
View Details
PSCA His Tag Protein, Mouse
UA011068-03 500 µg

PSCA His Tag Protein, Mouse

Sign In for Pricing
View Details