Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CORS26, Mouse (Myc, His)

CORS26 Protein is a secreted protein of the C1q/ TNF-associated protein (CTRPs) family. CORS26 Protein involved in the LAMP1-STAT3, SIRT1/NF-B/p53, NF-B and TGF-1/Smad3 pathways play anti-inflammatory effects. CORS26 Protein also inhibited the expression of antimicrobial peptide (CAMP) in adipocytes induced by toll-like receptors (TLR) . CORS26 Protein, Mouse (Myc, His) is the recombinant mouse-derived CORS26 protein, expressed by E. coli , with N-His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

CORS26 Protein, Mouse (Myc, His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cors26-protein-mouse-myc-his.html

Purity

90.0

Smiles

QDEYMESPQAGGLPPDCSKCCHGDYGFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGVPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYETKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK

Molecular Formula

81799 (Gene_ID) Q9ES30 (Q23-K246) (Accession)

Molecular Weight

Approximately 31.1 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RBMXL2 Protein Lysate 20ug
IHURBMXL2PLLY20UG 20 µg

Human RBMXL2 Protein Lysate 20ug

Sign In for Pricing
View Details
Crotalaria juncea Lectin (CJL) - Cy5
21761099-1 Inquire

Crotalaria juncea Lectin (CJL) - Cy5

Sign In for Pricing
View Details
SOX9 Conjugated Antibody
orb1617173 100 µL

SOX9 Conjugated Antibody

Sign In for Pricing
View Details
T.pallidum p15 Protein
OPPA01584-100UG 100 µg

T.pallidum p15 Protein

Sign In for Pricing
View Details
Olr17 Protein Vector (Rat) (pPB-N-His)
PV289019 500 ng

Olr17 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
HOXA3 Mouse Monoclonal Antibody [Clone:1A1]
E45M20320 100 µg

HOXA3 Mouse Monoclonal Antibody [Clone:1A1]

Sign In for Pricing
View Details