Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CORS26, Mouse (Myc, His)

CORS26 Protein is a secreted protein of the C1q/ TNF-associated protein (CTRPs) family. CORS26 Protein involved in the LAMP1-STAT3, SIRT1/NF-B/p53, NF-B and TGF-1/Smad3 pathways play anti-inflammatory effects. CORS26 Protein also inhibited the expression of antimicrobial peptide (CAMP) in adipocytes induced by toll-like receptors (TLR) . CORS26 Protein, Mouse (Myc, His) is the recombinant mouse-derived CORS26 protein, expressed by E. coli , with N-His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

CORS26 Protein, Mouse (Myc, His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cors26-protein-mouse-myc-his.html

Purity

90.0

Smiles

QDEYMESPQAGGLPPDCSKCCHGDYGFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGVPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYETKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK

Molecular Formula

81799 (Gene_ID) Q9ES30 (Q23-K246) (Accession)

Molecular Weight

Approximately 31.1 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Olfactory receptor 1N1 (OR1N1) ELISA kit
GTR10453337 96 Well

Sheep Olfactory receptor 1N1 (OR1N1) ELISA kit

Sign In for Pricing
View Details
Epsin2B Polyclonal Antibody, PE Conjugated
bs-9485R-PE 100 µL

Epsin2B Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
Presenilin 1 (PSEN1) Rabbit Polyclonal Antibody
RA19040-100 100 µg

Presenilin 1 (PSEN1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KRAS Knockout Jurkat Polyclonal Cells
ARG23385 1 Million

KRAS Knockout Jurkat Polyclonal Cells

Sign In for Pricing
View Details
SCF525 (50x50mm)
2008061 1 Each

SCF525 (50x50mm)

Sign In for Pricing
View Details
Lentiviral human KLF9 shRNA (UAS) - Lentiviral human KLF9 shRNA (UAS, GFP) (25)
GTR15323291 1 Vial

Lentiviral human KLF9 shRNA (UAS) - Lentiviral human KLF9 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details