Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CORS26, Mouse (Myc, His)

CORS26 Protein is a secreted protein of the C1q/ TNF-associated protein (CTRPs) family. CORS26 Protein involved in the LAMP1-STAT3, SIRT1/NF-B/p53, NF-B and TGF-1/Smad3 pathways play anti-inflammatory effects. CORS26 Protein also inhibited the expression of antimicrobial peptide (CAMP) in adipocytes induced by toll-like receptors (TLR) . CORS26 Protein, Mouse (Myc, His) is the recombinant mouse-derived CORS26 protein, expressed by E. coli , with N-His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

CORS26 Protein, Mouse (Myc, His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cors26-protein-mouse-myc-his.html

Purity

90.0

Smiles

QDEYMESPQAGGLPPDCSKCCHGDYGFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGVPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYETKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK

Molecular Formula

81799 (Gene_ID) Q9ES30 (Q23-K246) (Accession)

Molecular Weight

Approximately 31.1 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Angptl4 Rabbit pAb
E2252206 100 µL

Angptl4 Rabbit pAb

Sign In for Pricing
View Details
UBE2K sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2572608 1.0 µg DNA

UBE2K sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Recombinant Oncorhynchus mykiss Translocon-associated protein subunit alpha (ssr1), partial
MBS7057168 Inquire

Recombinant Oncorhynchus mykiss Translocon-associated protein subunit alpha (ssr1), partial

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Leucine Rich Repeat Containing Protein 32 (LRRC32)
MBS2084733-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Leucine Rich Repeat Containing Protein 32 (LRRC32)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Leucine Rich Repeat Containing Protein 32 (LRRC32)
MBS2084733-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Leucine Rich Repeat Containing Protein 32 (LRRC32)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Leucine Rich Repeat Containing Protein 32 (LRRC32)
MBS2084733-03 0.5 mL

APC/CY7-Linked Polyclonal Antibody to Leucine Rich Repeat Containing Protein 32 (LRRC32)

Sign In for Pricing
View Details