Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ras-related protein Rab-12 (RAB12)

Product Specifications

Abbreviation

Recombinant Human RAB12 protein

Gene Name

RAB12

UniProt

Q6IQ22

Expression Region

1-244aa

Organism

Homo sapiens (Human)

Target Sequence

MDPGAALQRRAGGGGGLGAGSPALSGGQGRRRKQPPRPADFKLQVIIIGSRGVGKTSLMERFTDDTFCEACKSTVGVDFKIKTVELRGKKIRLQIWDTAGQERFNSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCETDREITRQQGEKFAQQITGMRFCEASAKDNFNVDEIFLKLVDDILKKMPLDILRNELSNSILSLQPEPEIPPELPPPRPHVRCC

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. That Rab may play a role in protein transport from recycling endosomes to lysosomes regulating, for instance, the degradation of the transferrin receptor. Involved in autophagy.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

34.7 kDa

References & Citations

"Family-wide characterization of the DENN domain Rab GDP-GTP exchange factors." Yoshimura S., Gerondopoulos A., Linford A., Rigden D.J., Barr F.A. J. Cell Biol. 191:367-381 (2010)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fosizensertib
HY-168974 1 Each

Fosizensertib

Sign In for Pricing
View Details
Geldanamycin
TRC-G304500-10MG 10 mg

Geldanamycin

Sign In for Pricing
View Details
Pitx3 3'UTR GFP Stable Cell Line
TU166426 1.0 mL

Pitx3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Mouse latent transforming growth factor beta binding protein 3, LTBP3 ELISA Kit
MBS9304632-01 48 Well

Mouse latent transforming growth factor beta binding protein 3, LTBP3 ELISA Kit

Sign In for Pricing
View Details
Mouse latent transforming growth factor beta binding protein 3, LTBP3 ELISA Kit
MBS9304632-02 96 Well

Mouse latent transforming growth factor beta binding protein 3, LTBP3 ELISA Kit

Sign In for Pricing
View Details
Mouse latent transforming growth factor beta binding protein 3, LTBP3 ELISA Kit
MBS9304632-03 5x 96 Well

Mouse latent transforming growth factor beta binding protein 3, LTBP3 ELISA Kit

Sign In for Pricing
View Details