Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAK1, Human (His-SUMO)

PAK1 is a dynamic protein kinase that plays an important role in multiple intracellular signaling pathways, affecting cytoskeletal dynamics, adhesion, migration, proliferation, apoptosis, mitosis, and vesicle trafficking. Multifunctional PAK1 directly phosphorylates BAD to provide antiapoptotic cell protection. PAK1 Protein, Human (His-SUMO) is the recombinant human-derived PAK1 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Product Specifications

Product Name Alternative

PAK1 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pak1-protein-human-his-sumo.html

Purity

90.00

Smiles

MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILPGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATKNNH

Molecular Formula

5058 (Gene_ID) Q13153-1 (M1-H545) (Accession)

Molecular Weight

Approximately 76.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine B Cell Differetiation Factor BCDE ELISA Kit
BG-POR10381 1 Each

Porcine B Cell Differetiation Factor BCDE ELISA Kit

Sign In for Pricing
View Details
B7-H2, Avi-His-Tag, Biotin-Labeled
79300-1 25 µg

B7-H2, Avi-His-Tag, Biotin-Labeled

Sign In for Pricing
View Details
BIN3 Polyclonal Antibody
MBS8570160-01 0.1 mL

BIN3 Polyclonal Antibody

Sign In for Pricing
View Details
BIN3 Polyclonal Antibody
MBS8570160-02 0.1 mL (AF405L)

BIN3 Polyclonal Antibody

Sign In for Pricing
View Details
BIN3 Polyclonal Antibody
MBS8570160-03 0.1 mL (AF405S)

BIN3 Polyclonal Antibody

Sign In for Pricing
View Details
BIN3 Polyclonal Antibody
MBS8570160-04 0.1 mL (AF610)

BIN3 Polyclonal Antibody

Sign In for Pricing
View Details