Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Complement component C8 beta chain (C8B)

Product Specifications

Product Name Alternative

Complement component 8 subunit beta

Abbreviation

Recombinant Human C8B protein

Gene Name

C8B

UniProt

P07358

Expression Region

55-591aa

Organism

Homo sapiens (Human)

Target Sequence

SVDVTLMPIDCELSSWSSWTTCDPCQKKRYRYAYLLQPSQFHGEPCNFSDKEVEDCVTNRPCRSQVRCEGFVCAQTGRCVNRRLLCNGDNDCGDQSDEANCRRIYKKCQHEMDQYWGIGSLASGINLFTNSFEGPVLDHRYYAGGCSPHYILNTRFRKPYNVESYTPQTQGKYEFILKEYESYSDFERNVTEKMASKSGFSFGFKIPGIFELGISSQSDRGKHYIRRTKRFSHTKSVFLHARSDLEVAHYKLKPRSLMLHYEFLQRVKRLPLEYSYGEYRDLFRDFGTHYITEAVLGGIYEYTLVMNKEAMERGDYTLNNVHACAKNDFKIGGAIEEVYVSLGVSVGKCRGILNEIKDRNKRDTMVEDLVVLVRGGASEHITTLAYQELPTADLMQEWGDAVQYNPAIIKVKVEPLYELVTATDFAYSSTVRQNMKQALEEFQKEVSSCHCAPCQGNGVPVLKGSRCDCICPVGSQGLACEVSYRKNTPIDGKWNCWSNWSSCSGRRKTRQRQCNNPPPQNGGSPCSGPASETLDCS

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Cardiovascular

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

68.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Relaxin 3 (RLN3) Polyclonal Antibody
CAU23017-01 100 µL

Relaxin 3 (RLN3) Polyclonal Antibody

Sign In for Pricing
View Details
Relaxin 3 (RLN3) Polyclonal Antibody
CAU23017-02 200 µL

Relaxin 3 (RLN3) Polyclonal Antibody

Sign In for Pricing
View Details
Relaxin 3 (RLN3) Polyclonal Antibody
CAU23017-03 1 mL

Relaxin 3 (RLN3) Polyclonal Antibody

Sign In for Pricing
View Details
NR2C1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
32130111 3x 1.0 µg

NR2C1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Genesig® Advanced kit for C.pneumoniae
Z-Path-C.pneumoniae 150 Tests

Genesig® Advanced kit for C.pneumoniae

Sign In for Pricing
View Details
Parathyroid hormone (FITC)
327497-01 50 µg

Parathyroid hormone (FITC)

Sign In for Pricing
View Details