Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tissue alpha-L-Fucosidase, Mouse (His-SUMO)

Tissue alpha-L-Fucosidase Proteinas, an enzymatic entity, crucially hydrolyzes alpha-1,6-linked fucose residues on glycoproteins' carbohydrate moieties. Tissue alpha-L-Fucosidase Protein, Mouse (His-SUMO) is the recombinant mouse-derived Tissue alpha-L-Fucosidase protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Tissue alpha-L-Fucosidase Protein, Mouse (His-SUMO), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tissue-alpha-l-fucosidase-protein-mouse-his-sumo.html

Smiles

LAPRRFTPDWQSLDSRPLPSWFDEAKFGVFVHWGVFSVPAWGSEWFWWHWQGDRMPAYQRFMTENYPPGFSYADFAPQFTARFFHPDQWAELFQAAGAKYVVLTTKHHEGFTNWPSPVSWNWNSKDVGPHRDLVGELGAAVRKRNIRYGLYHSLLEWFHPLYLLDKKNGFKTQHFVRAKTMPELYDLVNSYKPDLIWSDGEWECPDTYWNSTSFLAWLYNDSPVKDEVIVNDRWGQNCSCHHGGYYNCQDKYKPQSLPDHKWEMCTSMDRASWGYRKDMTMSTIAKENEIIEELVQTVSLGGNYLLNIGPTKDGLIVPIFQERLLAVGKWLQINGEAIYASKPWRVQSEKNKTVVWYTTKNATVYATFLYWPENGIVNLKSPKTTSATKITMLGLEGDLSWTQDPLEGVLISLPQLPPTVLPVEFAWTLKLTKVN

Molecular Formula

71665 (Gene_ID) Q99LJ1 (L18-N452) (Accession)

Molecular Weight

Approximately 66.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adenosine- 5'- O- (α, β- methylene) diphosphate (AMP-CP), sodium salt
A 070-05 5 µmol ~ 2.1 mg

Adenosine- 5'- O- (α, β- methylene) diphosphate (AMP-CP), sodium salt

Sign In for Pricing
View Details
Oplodiol
MF-0051414 5 mg

Oplodiol

Sign In for Pricing
View Details
PcDNA3.0-HA-RNF126
PPL00447-2c 1 Each

PcDNA3.0-HA-RNF126

Sign In for Pricing
View Details
Pack of 1000 Mce Syringe Filter 0.45µm, 33 Mm
SF33ME45M Pack of 1000

Pack of 1000 Mce Syringe Filter 0.45µm, 33 Mm

Sign In for Pricing
View Details
Clec7a Mouse shRNA Plasmid (Locus ID 56644)
TR503236 1 Kit

Clec7a Mouse shRNA Plasmid (Locus ID 56644)

Sign In for Pricing
View Details
Human RAS guanyl-releasing protein 4 (RASGRP4) ELISA Kit
abx526292 96 Tests

Human RAS guanyl-releasing protein 4 (RASGRP4) ELISA Kit

Sign In for Pricing
View Details