Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human G antigen 7 (GAGE7)

Product Specifications

Product Name Alternative

(GAGE-7) (AL4) (Cancer/testis antigen 4.7) (CT4.7) (GAGE-12I) (GAGE-7B) (GAGE-8)

Abbreviation

Recombinant Human GAGE7 protein

Gene Name

GAGE7

UniProt

O76087

Expression Region

1-117aa

Organism

Homo sapiens (Human)

Target Sequence

MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

18.9 kDa

References & Citations

"An overview of the GAGE cancer/testis antigen family with the inclusion of newly identified members." Gjerstorff M.F., Ditzel H.J. Tissue Antigens 71:187-192 (2008)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BRN4 (POU3F4) (NM_000307) Human Over-expression Lysate
LY424806 100 µg

BRN4 (POU3F4) (NM_000307) Human Over-expression Lysate

Sign In for Pricing
View Details
Hsa-miR-4665-3p miRNA Antagomir
CIJ1474-01 10 nmol

Hsa-miR-4665-3p miRNA Antagomir

Sign In for Pricing
View Details
Hsa-miR-4665-3p miRNA Antagomir
CIJ1474-02 20 nmol

Hsa-miR-4665-3p miRNA Antagomir

Sign In for Pricing
View Details
3,3'-Dihexyloxacarbocyanine Iodide
B2012436 50 mg

3,3'-Dihexyloxacarbocyanine Iodide

Sign In for Pricing
View Details
Luciferase & GFP Stable Expressing MB49 Cells
T1263 1x106 cells / 1.0 mL

Luciferase & GFP Stable Expressing MB49 Cells

Sign In for Pricing
View Details
Canine Interleukin 5 (IL5) ELISA Kit
MBS456503-01 48 Tests

Canine Interleukin 5 (IL5) ELISA Kit

Sign In for Pricing
View Details